BLASTX nr result
ID: Coptis21_contig00028148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00028148 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD25641.1| En/Spm-like transposon protein [Arabidopsis thali... 65 8e-09 gb|AAC97238.1| En/Spm-like transposon protein [Arabidopsis thali... 60 2e-07 >gb|AAD25641.1| En/Spm-like transposon protein [Arabidopsis thaliana] Length = 531 Score = 64.7 bits (156), Expect = 8e-09 Identities = 31/56 (55%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = -1 Query: 215 RFIKDVLLDYYTFRIPIFNCYWANVRNGVKVEDGLTLVNLHQGQ-RLQKEPFITLS 51 R + +LLDY F IPIF C WAN+ NGVK EDG TLVNL+Q Q ++P+I S Sbjct: 74 RVVDIILLDYNVFYIPIFRCQWANIGNGVKEEDGFTLVNLNQSQVSFARDPYILAS 129 >gb|AAC97238.1| En/Spm-like transposon protein [Arabidopsis thaliana] Length = 781 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/51 (58%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Frame = -1 Query: 200 VLLDYYTFRIPIFNCYWANVRNGVKVEDGLTLVNLHQGQ-RLQKEPFITLS 51 +LLDY F +PIF C WA NGVKVEDG TLVNL+ Q K+PFI S Sbjct: 26 ILLDYNVFYVPIFRCQWAVRGNGVKVEDGFTLVNLNHSQVSFLKDPFILAS 76