BLASTX nr result
ID: Coptis21_contig00028067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00028067 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago ... 57 5e-10 >ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago truncatula] gi|355477332|gb|AES58535.1| hypothetical protein MTR_1g005250 [Medicago truncatula] Length = 197 Score = 57.4 bits (137), Expect(2) = 5e-10 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -3 Query: 94 YCSMEAGGLLEVRPGFSGVVGEGFTFLTHI 5 Y SMEAGGLLEVRPGF GVVGEG TFLTHI Sbjct: 111 YFSMEAGGLLEVRPGFFGVVGEGLTFLTHI 140 Score = 31.2 bits (69), Expect(2) = 5e-10 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -2 Query: 251 LFLSIEK-ESAVCASHLLLGSAGRHGILVQI*AGRTCDGSQGSNM 120 LFLSIEK ESAVCA GRTCDGS SN+ Sbjct: 75 LFLSIEKKESAVCA-------------------GRTCDGSPRSNI 100