BLASTX nr result
ID: Coptis21_contig00028058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00028058 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004148419.1| PREDICTED: universal stress protein A-like p... 57 2e-06 >ref|XP_004148419.1| PREDICTED: universal stress protein A-like protein-like [Cucumis sativus] gi|449518061|ref|XP_004166062.1| PREDICTED: universal stress protein A-like protein-like [Cucumis sativus] Length = 175 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = -2 Query: 147 MTEKLKCVVVAVNSSEESMNALKWALHNLKLHSSDSDEGEPSALVILHV 1 M+ L+CV+VAV+ S+ESM AL+WAL NLKLHSS D + V LHV Sbjct: 1 MSSDLRCVIVAVDGSDESMGALRWALQNLKLHSSSPDSTD-GTFVALHV 48