BLASTX nr result
ID: Coptis21_contig00028027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00028027 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP55551.1| mutator-like transposase [Rosa rugosa] 42 1e-07 >gb|AFP55551.1| mutator-like transposase [Rosa rugosa] Length = 721 Score = 41.6 bits (96), Expect(2) = 1e-07 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = +2 Query: 101 KMMNMASERRMECRKWKSVLCPKIEAKLAERTEMARCLTVIRSEEYVFQI 250 K M + R+ + +W S LCP IE KL + E+ R V RS+ YV+++ Sbjct: 542 KSMASIAARKQDAHEWFSELCPVIEKKLKDNLEVGRHWRVSRSDTYVYEV 591 Score = 38.9 bits (89), Expect(2) = 1e-07 Identities = 17/34 (50%), Positives = 25/34 (73%) Frame = +3 Query: 3 YGEMCSSLAESFNNWIDKERYLPITAMLDEIRIR 104 +GEM ++LAESFNNW+ + LPI + D IR++ Sbjct: 509 FGEMTNNLAESFNNWVLPLKSLPILDINDGIRVK 542