BLASTX nr result
ID: Coptis21_contig00027960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00027960 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003622403.1| AAA-ATPase 1-like protein [Medicago truncatu... 67 2e-09 ref|XP_003525061.1| PREDICTED: uncharacterized protein LOC100798... 66 3e-09 ref|XP_002511494.1| ATP binding protein, putative [Ricinus commu... 64 2e-08 ref|XP_002267418.2| PREDICTED: mitochondrial chaperone BCS1 isof... 61 1e-07 emb|CAN77016.1| hypothetical protein VITISV_010516 [Vitis vinifera] 60 1e-07 >ref|XP_003622403.1| AAA-ATPase 1-like protein [Medicago truncatula] gi|355497418|gb|AES78621.1| AAA-ATPase 1-like protein [Medicago truncatula] Length = 520 Score = 66.6 bits (161), Expect = 2e-09 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -3 Query: 128 EMWASLGTTLASFMFMWAMIRQYLPYDLHRYIEKYAHRLFSF 3 EMW ++G+TLASFMF+WA+IRQY PY L R+ EKY+HR+ + Sbjct: 8 EMWTTMGSTLASFMFIWAIIRQYCPYQLLRFFEKYSHRIMDY 49 >ref|XP_003525061.1| PREDICTED: uncharacterized protein LOC100798176 [Glycine max] Length = 507 Score = 65.9 bits (159), Expect = 3e-09 Identities = 24/44 (54%), Positives = 35/44 (79%) Frame = -3 Query: 134 LGEMWASLGTTLASFMFMWAMIRQYLPYDLHRYIEKYAHRLFSF 3 + EMW ++G+TLASFMF+W ++RQY PY + R+ EKY HR+ S+ Sbjct: 3 ISEMWTTMGSTLASFMFLWTIMRQYCPYGVQRFFEKYTHRIMSY 46 >ref|XP_002511494.1| ATP binding protein, putative [Ricinus communis] gi|223550609|gb|EEF52096.1| ATP binding protein, putative [Ricinus communis] Length = 505 Score = 63.5 bits (153), Expect = 2e-08 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -3 Query: 128 EMWASLGTTLASFMFMWAMIRQYLPYDLHRYIEKYAHRLFSF 3 EMWA++G+T+ASFMF+WA+ RQY PY++ RY EKY + +F Sbjct: 3 EMWATMGSTIASFMFIWAIFRQYCPYEVRRYFEKYTQGIMTF 44 >ref|XP_002267418.2| PREDICTED: mitochondrial chaperone BCS1 isoform 1 [Vitis vinifera] Length = 474 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -3 Query: 134 LGEMWASLGTTLASFMFMWAMIRQYLPYDLHRYIEKYAHRLFSF 3 +GEM LG+ +A+ MF+WAM +QY P+DL R+ EKY+HRL F Sbjct: 1 MGEMLGDLGSVMAALMFIWAMFQQYFPHDLRRHFEKYSHRLMKF 44 >emb|CAN77016.1| hypothetical protein VITISV_010516 [Vitis vinifera] Length = 474 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = -3 Query: 134 LGEMWASLGTTLASFMFMWAMIRQYLPYDLHRYIEKYAHRL 12 +GEM +LG+ +A+ MF+WAM +QY P+DL R+IEKY+HRL Sbjct: 1 MGEMLGNLGSVMAALMFIWAMFQQYFPHDLRRHIEKYSHRL 41