BLASTX nr result
ID: Coptis21_contig00027697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00027697 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271216.2| PREDICTED: peptide transporter PTR3-A-like [... 77 2e-12 ref|XP_004147160.1| PREDICTED: peptide transporter PTR3-A-like [... 67 1e-09 ref|XP_002526567.1| oligopeptide transporter, putative [Ricinus ... 65 6e-09 ref|XP_002285402.1| PREDICTED: peptide transporter PTR3-A [Vitis... 65 7e-09 emb|CAN63331.1| hypothetical protein VITISV_015576 [Vitis vinifera] 65 7e-09 >ref|XP_002271216.2| PREDICTED: peptide transporter PTR3-A-like [Vitis vinifera] Length = 624 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/60 (58%), Positives = 46/60 (76%), Gaps = 3/60 (5%) Frame = -2 Query: 306 LNISHLDYYYGFYVVLTFLNFIFFLVVAKYYVYNADV---ESERGLPNPRELVPSQGKTQ 136 LN+SHLDY+Y FY +L+F+NF+FFLVVAK+YVYN DV ES+R L E PS+ ++Q Sbjct: 555 LNVSHLDYFYAFYAILSFVNFLFFLVVAKFYVYNVDVDMTESKRELQKAMETSPSEARSQ 614 >ref|XP_004147160.1| PREDICTED: peptide transporter PTR3-A-like [Cucumis sativus] gi|449498602|ref|XP_004160581.1| PREDICTED: peptide transporter PTR3-A-like [Cucumis sativus] Length = 592 Score = 67.0 bits (162), Expect = 1e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 306 LNISHLDYYYGFYVVLTFLNFIFFLVVAKYYVYNADV 196 LN SHLDYYYGF+ +L FLNFIFFLVV++YYVY A+V Sbjct: 531 LNASHLDYYYGFFAILNFLNFIFFLVVSRYYVYKAEV 567 >ref|XP_002526567.1| oligopeptide transporter, putative [Ricinus communis] gi|223534128|gb|EEF35845.1| oligopeptide transporter, putative [Ricinus communis] Length = 598 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = -2 Query: 306 LNISHLDYYYGFYVVLTFLNFIFFLVVAKYYVYNADVESERGL 178 LNISHLDYYY F +L+FLNF+ +L+VAK++VYN D ES+R + Sbjct: 543 LNISHLDYYYAFLAILSFLNFLAYLLVAKFFVYNVDQESKRNM 585 >ref|XP_002285402.1| PREDICTED: peptide transporter PTR3-A [Vitis vinifera] gi|296083701|emb|CBI23690.3| unnamed protein product [Vitis vinifera] Length = 592 Score = 64.7 bits (156), Expect = 7e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -2 Query: 306 LNISHLDYYYGFYVVLTFLNFIFFLVVAKYYVYNADV 196 LN SHLDYYY F+ +L FLNFIFF+VV KYYVY A+V Sbjct: 530 LNASHLDYYYAFFAILNFLNFIFFIVVTKYYVYKAEV 566 >emb|CAN63331.1| hypothetical protein VITISV_015576 [Vitis vinifera] Length = 586 Score = 64.7 bits (156), Expect = 7e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -2 Query: 306 LNISHLDYYYGFYVVLTFLNFIFFLVVAKYYVYNADV 196 LN SHLDYYY F+ +L FLNFIFF+VV KYYVY A+V Sbjct: 530 LNASHLDYYYAFFAILNFLNFIFFIVVTKYYVYKAEV 566