BLASTX nr result
ID: Coptis21_contig00027659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00027659 (462 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275523.2| PREDICTED: uncharacterized protein LOC100264... 82 4e-14 ref|XP_003594872.1| hypothetical protein MTR_2g035660 [Medicago ... 79 3e-13 ref|XP_002528137.1| conserved hypothetical protein [Ricinus comm... 79 3e-13 ref|XP_003533613.1| PREDICTED: ribulose-1,5 bisphosphate carboxy... 79 5e-13 ref|XP_003546388.1| PREDICTED: ribulose-1,5 bisphosphate carboxy... 75 5e-12 >ref|XP_002275523.2| PREDICTED: uncharacterized protein LOC100264713 [Vitis vinifera] gi|297738036|emb|CBI27237.3| unnamed protein product [Vitis vinifera] Length = 482 Score = 82.0 bits (201), Expect = 4e-14 Identities = 51/94 (54%), Positives = 62/94 (65%), Gaps = 9/94 (9%) Frame = -2 Query: 257 MASLPL-QLPNLSFISNNPKLKCFG--SSTPKHTSF-----HFKPISASVETPPFRLFEP 102 MAS PL P FIS+N C G SS P ++ + +PI A+VE PPF LFEP Sbjct: 1 MASSPLLHHPTHCFISSNQGF-CNGLSSSRPNYSWMRGSGNNIRPIKAAVEMPPFPLFEP 59 Query: 101 SHSE-ESVSELEPADPDFYKIGYIRSVRAYGVDF 3 E ++ S+LEPADPDFYKIGY+RSVRAYGV+F Sbjct: 60 PQIESDTPSQLEPADPDFYKIGYVRSVRAYGVEF 93 >ref|XP_003594872.1| hypothetical protein MTR_2g035660 [Medicago truncatula] gi|355483920|gb|AES65123.1| hypothetical protein MTR_2g035660 [Medicago truncatula] Length = 363 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -2 Query: 152 KPISASVETPPFRLFEPSHSEESVSELEPADPDFYKIGYIRSVRAYGVDF 3 +P+ ASVET PF LF+P EE+ S+LEP DPDFYKIG++RS+RAYGVDF Sbjct: 42 QPVKASVETAPFPLFQPPKDEETASQLEPVDPDFYKIGFVRSMRAYGVDF 91 >ref|XP_002528137.1| conserved hypothetical protein [Ricinus communis] gi|223532435|gb|EEF34228.1| conserved hypothetical protein [Ricinus communis] Length = 483 Score = 79.3 bits (194), Expect = 3e-13 Identities = 45/84 (53%), Positives = 56/84 (66%), Gaps = 6/84 (7%) Frame = -2 Query: 236 LPNLSFISNNPKLKCFGSSTPKHTSFH-----FKPISAS-VETPPFRLFEPSHSEESVSE 75 L + SFIS + ++ PK+T +PI AS VE PPF LF+ +EES SE Sbjct: 11 LTHCSFISLQQYKEGLITARPKYTFSRNSDNVVRPIKASSVEAPPFPLFQSPKTEESSSE 70 Query: 74 LEPADPDFYKIGYIRSVRAYGVDF 3 LEPADPDFYKIGY+RS+RAYGV+F Sbjct: 71 LEPADPDFYKIGYVRSMRAYGVEF 94 >ref|XP_003533613.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic-like [Glycine max] Length = 482 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = -2 Query: 152 KPISASVETPPFRLFEPSHSEESVSELEPADPDFYKIGYIRSVRAYGVDF 3 +PI ASV PPF LF+P EE+ SELEPADPDFYKIGY+RS+RAYGV F Sbjct: 44 RPIKASVGAPPFPLFKPPQVEETSSELEPADPDFYKIGYVRSMRAYGVHF 93 >ref|XP_003546388.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic-like [Glycine max] Length = 483 Score = 75.1 bits (183), Expect = 5e-12 Identities = 36/51 (70%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -2 Query: 152 KPISASVETPPFRLFEPSHSEESVS-ELEPADPDFYKIGYIRSVRAYGVDF 3 +PI ASV PPF LF+P EE+ S ELEPADPDFYKIGY+RS+RAYGV F Sbjct: 44 RPIRASVGAPPFPLFQPPQVEETTSSELEPADPDFYKIGYVRSMRAYGVQF 94