BLASTX nr result
ID: Coptis21_contig00027469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00027469 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605166.1| Peptide transporter [Medicago truncatula] gi... 55 6e-06 >ref|XP_003605166.1| Peptide transporter [Medicago truncatula] gi|355506221|gb|AES87363.1| Peptide transporter [Medicago truncatula] Length = 622 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/41 (56%), Positives = 35/41 (85%) Frame = -3 Query: 125 QQRQKYAIEGGEELSSVSIFWQIPQYIIFGVSEALMYVAQL 3 ++R ++A + G+E SS+SIFWQIPQY++ GV+EA +YVAQ+ Sbjct: 433 RKRLEFASKDGKETSSLSIFWQIPQYVLVGVAEAFVYVAQM 473