BLASTX nr result
ID: Coptis21_contig00027301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00027301 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531984.1| conserved hypothetical protein [Ricinus comm... 71 8e-11 ref|XP_002311149.1| predicted protein [Populus trichocarpa] gi|2... 71 8e-11 ref|XP_003633459.1| PREDICTED: uncharacterized protein LOC100853... 69 4e-10 emb|CBI31718.3| unnamed protein product [Vitis vinifera] 69 4e-10 ref|XP_003555814.1| PREDICTED: uncharacterized protein LOC100815... 67 1e-09 >ref|XP_002531984.1| conserved hypothetical protein [Ricinus communis] gi|223528381|gb|EEF30420.1| conserved hypothetical protein [Ricinus communis] Length = 91 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 182 FWCASFLIAWAAVLQGHMMWLKRQDSFKNKFGTLEEEEDEIN 307 FW ASFLI WAA LQGHMMWL+RQDSFK KFGTL + +++ N Sbjct: 12 FWFASFLIGWAAALQGHMMWLQRQDSFKQKFGTLNQNDNDSN 53 >ref|XP_002311149.1| predicted protein [Populus trichocarpa] gi|222850969|gb|EEE88516.1| predicted protein [Populus trichocarpa] Length = 59 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +2 Query: 185 WCASFLIAWAAVLQGHMMWLKRQDSFKNKFGTLEEEEDEI 304 W ASFLIAWAA LQGHMMWL+RQDSFK KFGTL E+ ++ Sbjct: 17 WFASFLIAWAAALQGHMMWLRRQDSFKQKFGTLNEDNSDV 56 >ref|XP_003633459.1| PREDICTED: uncharacterized protein LOC100853537 [Vitis vinifera] Length = 106 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 182 FWCASFLIAWAAVLQGHMMWLKRQDSFKNKFGTLEEEEDEIN 307 FW ASFL+AWAA LQGHMMWL+RQD+FK KFG L ++ D N Sbjct: 65 FWVASFLVAWAAALQGHMMWLQRQDAFKQKFGDLGQDHDPEN 106 >emb|CBI31718.3| unnamed protein product [Vitis vinifera] Length = 387 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 182 FWCASFLIAWAAVLQGHMMWLKRQDSFKNKFGTLEEEEDEIN 307 FW ASFL+AWAA LQGHMMWL+RQD+FK KFG L ++ D N Sbjct: 346 FWVASFLVAWAAALQGHMMWLQRQDAFKQKFGDLGQDHDPEN 387 >ref|XP_003555814.1| PREDICTED: uncharacterized protein LOC100815740 [Glycine max] Length = 55 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +2 Query: 182 FWCASFLIAWAAVLQGHMMWLKRQDSFKNKFGTLEEEEDEIN 307 FW ASFLIAWAA LQGHMMWL+RQDSFK+KFG ++ N Sbjct: 14 FWMASFLIAWAAALQGHMMWLQRQDSFKHKFGNPDDHPHNSN 55