BLASTX nr result
ID: Coptis21_contig00027267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00027267 (550 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24313.3| unnamed protein product [Vitis vinifera] 57 1e-06 ref|XP_002267829.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 >emb|CBI24313.3| unnamed protein product [Vitis vinifera] Length = 407 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 548 YMLLANMYADSGRYNDAEKVRDFMKQRSASKVPGCS 441 Y++LAN+YA +GR+ DAEKVR MKQR SKVPGCS Sbjct: 368 YVMLANIYAGAGRFEDAEKVRQLMKQRKLSKVPGCS 403 >ref|XP_002267829.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14170-like [Vitis vinifera] Length = 455 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 548 YMLLANMYADSGRYNDAEKVRDFMKQRSASKVPGCS 441 Y++LAN+YA +GR+ DAEKVR MKQR SKVPGCS Sbjct: 416 YVMLANIYAGAGRFEDAEKVRQLMKQRKLSKVPGCS 451