BLASTX nr result
ID: Coptis21_contig00027100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00027100 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529321.1| cellulose synthase, putative [Ricinus commun... 57 1e-06 >ref|XP_002529321.1| cellulose synthase, putative [Ricinus communis] gi|223531245|gb|EEF33090.1| cellulose synthase, putative [Ricinus communis] Length = 762 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/70 (42%), Positives = 45/70 (64%), Gaps = 3/70 (4%) Frame = +3 Query: 105 GNSEEFIESLRRDYKTNAFDNDVDTLASLLYEARLLASCTYEQHTQWGEQANFL---ITE 275 G S EFI+SL+ DYK ++ + ++ SLL EA++LASCTYE T+WG++ FL + E Sbjct: 389 GTSNEFIKSLKPDYKPSSMRREGES--SLLQEAKVLASCTYENSTKWGKEVGFLYDTVVE 446 Query: 276 PEISFLRTNC 305 + L +C Sbjct: 447 DYFTGLTMHC 456