BLASTX nr result
ID: Coptis21_contig00026745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00026745 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533785.1| PREDICTED: cysteine proteinase [Glycine max] 55 8e-06 ref|NP_001237820.1| cysteine protease-like precursor [Glycine ma... 55 8e-06 gb|AAQ96835.1| cysteine proteinase [Glycine max] 55 8e-06 >ref|XP_003533785.1| PREDICTED: cysteine proteinase [Glycine max] Length = 354 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 99 VFSNSVKNSCWQDVNHAVLAVGYGVENGIPYWL 1 VF++ S QDVNHAVLAVGYGVENG+PYWL Sbjct: 286 VFTSDTCGSTSQDVNHAVLAVGYGVENGVPYWL 318 >ref|NP_001237820.1| cysteine protease-like precursor [Glycine max] gi|149393486|gb|ABR26679.1| putative cysteine protease [Glycine max] Length = 355 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 99 VFSNSVKNSCWQDVNHAVLAVGYGVENGIPYWL 1 V+++ + S QDVNHAVLAVGYGVENG+PYWL Sbjct: 286 VYTSDICGSTSQDVNHAVLAVGYGVENGVPYWL 318 >gb|AAQ96835.1| cysteine proteinase [Glycine max] Length = 215 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 99 VFSNSVKNSCWQDVNHAVLAVGYGVENGIPYWL 1 VF++ S QDVNHAVLAVGYGVENG+PYWL Sbjct: 129 VFTSDTCGSTSQDVNHAVLAVGYGVENGVPYWL 161