BLASTX nr result
ID: Coptis21_contig00026549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00026549 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus ... 59 3e-07 >ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527546|gb|EEF29668.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 389 Score = 59.3 bits (142), Expect = 3e-07 Identities = 35/71 (49%), Positives = 44/71 (61%), Gaps = 2/71 (2%) Frame = +3 Query: 81 IVSFDLGVEDFRVFPTPVRVNGHYPLMNCTLGV--LDDCLSLANTSTGQSVDVWVMKDYD 254 IV+ DLGVED+ V P P V+ MNC +GV L CLSL + + VDVWVM++Y Sbjct: 223 IVALDLGVEDYHVVPKPEFVD-----MNCNMGVGVLQGCLSLLAYARSERVDVWVMEEYM 277 Query: 255 GKISGNKKFSV 287 K S +K FSV Sbjct: 278 VKESWSKLFSV 288