BLASTX nr result
ID: Coptis21_contig00026428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00026428 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588767.1| Seed specific protein Bn15D14A [Medicago tru... 56 4e-06 ref|XP_002285138.1| PREDICTED: uncharacterized protein LOC100244... 56 4e-06 ref|XP_002323363.1| predicted protein [Populus trichocarpa] gi|2... 56 4e-06 emb|CAN82789.1| hypothetical protein VITISV_030600 [Vitis vinifera] 56 4e-06 ref|XP_002524093.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_003588767.1| Seed specific protein Bn15D14A [Medicago truncatula] gi|355477815|gb|AES59018.1| Seed specific protein Bn15D14A [Medicago truncatula] Length = 458 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 93 IKQLRKNLTFKATPMPSFYQEPALPKAELKK 1 IK+LRK+LTFKATP+P+FYQEPA PK ELKK Sbjct: 271 IKKLRKSLTFKATPLPTFYQEPAPPKVELKK 301 >ref|XP_002285138.1| PREDICTED: uncharacterized protein LOC100244101 [Vitis vinifera] gi|296082039|emb|CBI21044.3| unnamed protein product [Vitis vinifera] Length = 439 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 93 IKQLRKNLTFKATPMPSFYQEPALPKAELKK 1 IK LRK+LTFKATPMPSFYQEP PK ELKK Sbjct: 286 IKMLRKSLTFKATPMPSFYQEPPPPKVELKK 316 >ref|XP_002323363.1| predicted protein [Populus trichocarpa] gi|222867993|gb|EEF05124.1| predicted protein [Populus trichocarpa] Length = 351 Score = 55.8 bits (133), Expect = 4e-06 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -2 Query: 132 NLKLMLERN**TNIKQLRKNLTFKATPMPSFYQEPALPKAELKK 1 NL+ + N IKQLRK+LTFKATPMPSFY+EP PKAELKK Sbjct: 149 NLQEKSKENQEAEIKQLRKSLTFKATPMPSFYKEPP-PKAELKK 191 >emb|CAN82789.1| hypothetical protein VITISV_030600 [Vitis vinifera] Length = 440 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 93 IKQLRKNLTFKATPMPSFYQEPALPKAELKK 1 IK LRK+LTFKATPMPSFYQEP PK ELKK Sbjct: 272 IKMLRKSLTFKATPMPSFYQEPPPPKVELKK 302 >ref|XP_002524093.1| conserved hypothetical protein [Ricinus communis] gi|223536661|gb|EEF38303.1| conserved hypothetical protein [Ricinus communis] Length = 484 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -2 Query: 132 NLKLMLERN**TNIKQLRKNLTFKATPMPSFYQEPALPKAELKK 1 NL+ + N IKQLRK+LTFKATPMPSFY+EP PK ELKK Sbjct: 286 NLQAKSQENQEAEIKQLRKSLTFKATPMPSFYKEPP-PKVELKK 328