BLASTX nr result
ID: Coptis21_contig00026369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00026369 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT40036.1| chitinase [Tripsacum dactyloides] 70 2e-10 ref|XP_002881917.1| hypothetical protein ARALYDRAFT_483470 [Arab... 69 3e-10 ref|NP_181887.1| chitinase-like protein [Arabidopsis thaliana] g... 69 4e-10 ref|XP_002534548.1| class IV chitinase, putative [Ricinus commun... 68 7e-10 emb|CAA87072.1| pathogenesis-related protein PR-3 type [Sambucus... 68 9e-10 >gb|AAT40036.1| chitinase [Tripsacum dactyloides] Length = 277 Score = 69.7 bits (169), Expect = 2e-10 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 138 NCGCAPNFCCSQYGYCGTDPEYCGPGCREGP 230 NCGC PNFCCS+YGYCGT EYCG GCR GP Sbjct: 29 NCGCQPNFCCSKYGYCGTSDEYCGDGCRSGP 59 >ref|XP_002881917.1| hypothetical protein ARALYDRAFT_483470 [Arabidopsis lyrata subsp. lyrata] gi|297327756|gb|EFH58176.1| hypothetical protein ARALYDRAFT_483470 [Arabidopsis lyrata subsp. lyrata] Length = 264 Score = 69.3 bits (168), Expect = 3e-10 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 138 NCGCAPNFCCSQYGYCGTDPEYCGPGCREGP 230 NCGCAPN CCSQ+GYCGTD YCG GCR GP Sbjct: 26 NCGCAPNLCCSQFGYCGTDDAYCGAGCRSGP 56 >ref|NP_181887.1| chitinase-like protein [Arabidopsis thaliana] gi|2281111|gb|AAB64047.1| putative endochitinase [Arabidopsis thaliana] gi|20196867|gb|AAM14810.1| putative endochitinase [Arabidopsis thaliana] gi|32815951|gb|AAP88360.1| At2g43590 [Arabidopsis thaliana] gi|110736333|dbj|BAF00136.1| putative endochitinase [Arabidopsis thaliana] gi|330255199|gb|AEC10293.1| chitinase-like protein [Arabidopsis thaliana] Length = 264 Score = 68.9 bits (167), Expect = 4e-10 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 138 NCGCAPNFCCSQYGYCGTDPEYCGPGCREGP 230 NCGCAPN CCSQ+GYCGTD YCG GCR GP Sbjct: 26 NCGCAPNLCCSQFGYCGTDDAYCGVGCRSGP 56 >ref|XP_002534548.1| class IV chitinase, putative [Ricinus communis] gi|223525062|gb|EEF27835.1| class IV chitinase, putative [Ricinus communis] Length = 271 Score = 68.2 bits (165), Expect = 7e-10 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 138 NCGCAPNFCCSQYGYCGTDPEYCGPGCREGP 230 NCGC+P CCSQYGYCG+ +YCGPGCR+GP Sbjct: 29 NCGCSPGLCCSQYGYCGSGKDYCGPGCRQGP 59 >emb|CAA87072.1| pathogenesis-related protein PR-3 type [Sambucus nigra] Length = 261 Score = 67.8 bits (164), Expect = 9e-10 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +3 Query: 138 NCGCAPNFCCSQYGYCGTDPEYCGPGCREGP 230 NCGCAPN CCSQ+GYCG+D YCG GCR GP Sbjct: 17 NCGCAPNLCCSQFGYCGSDAAYCGEGCRSGP 47