BLASTX nr result
ID: Coptis21_contig00026285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00026285 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264130.2| PREDICTED: pentatricopeptide repeat-containi... 125 3e-27 emb|CBI24193.3| unnamed protein product [Vitis vinifera] 125 3e-27 ref|XP_004149965.1| PREDICTED: pentatricopeptide repeat-containi... 121 5e-26 emb|CAN60118.1| hypothetical protein VITISV_016374 [Vitis vinifera] 120 9e-26 ref|XP_002310674.1| predicted protein [Populus trichocarpa] gi|2... 119 3e-25 >ref|XP_002264130.2| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Vitis vinifera] Length = 1724 Score = 125 bits (315), Expect = 3e-27 Identities = 57/66 (86%), Positives = 59/66 (89%) Frame = -3 Query: 200 ERLALAFSLIGTPEGSTIRIFKNLRVCGDCHSVYKFVSSVVQRKIVLRDPYRFHHFSGGN 21 ERLALAF LI TPE ST+RIFKNLRVCGDCHSVYKFVS +V RKIVLRDPYRFHHFSGG Sbjct: 1658 ERLALAFGLINTPESSTLRIFKNLRVCGDCHSVYKFVSGIVGRKIVLRDPYRFHHFSGGK 1717 Query: 20 CSCSDY 3 CSC DY Sbjct: 1718 CSCGDY 1723 >emb|CBI24193.3| unnamed protein product [Vitis vinifera] Length = 1083 Score = 125 bits (315), Expect = 3e-27 Identities = 57/66 (86%), Positives = 59/66 (89%) Frame = -3 Query: 200 ERLALAFSLIGTPEGSTIRIFKNLRVCGDCHSVYKFVSSVVQRKIVLRDPYRFHHFSGGN 21 ERLALAF LI TPE ST+RIFKNLRVCGDCHSVYKFVS +V RKIVLRDPYRFHHFSGG Sbjct: 1017 ERLALAFGLINTPESSTLRIFKNLRVCGDCHSVYKFVSGIVGRKIVLRDPYRFHHFSGGK 1076 Query: 20 CSCSDY 3 CSC DY Sbjct: 1077 CSCGDY 1082 >ref|XP_004149965.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Cucumis sativus] gi|449497665|ref|XP_004160467.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Cucumis sativus] Length = 938 Score = 121 bits (304), Expect = 5e-26 Identities = 54/66 (81%), Positives = 59/66 (89%) Frame = -3 Query: 200 ERLALAFSLIGTPEGSTIRIFKNLRVCGDCHSVYKFVSSVVQRKIVLRDPYRFHHFSGGN 21 ER+ALAF LI PEGST+RIFKNLRVCGDCHS +KFVS V+ RKIVLRDPYRFHHF+ GN Sbjct: 872 ERIALAFGLINIPEGSTVRIFKNLRVCGDCHSFFKFVSGVLGRKIVLRDPYRFHHFTNGN 931 Query: 20 CSCSDY 3 CSCSDY Sbjct: 932 CSCSDY 937 >emb|CAN60118.1| hypothetical protein VITISV_016374 [Vitis vinifera] Length = 1166 Score = 120 bits (302), Expect = 9e-26 Identities = 55/63 (87%), Positives = 57/63 (90%) Frame = -3 Query: 200 ERLALAFSLIGTPEGSTIRIFKNLRVCGDCHSVYKFVSSVVQRKIVLRDPYRFHHFSGGN 21 ERLALAF LI TPE ST+RIFKNLRVCGDCHSVYKFVS +V RKIVLRDPYRFHHFSGG Sbjct: 1008 ERLALAFGLINTPESSTLRIFKNLRVCGDCHSVYKFVSGIVGRKIVLRDPYRFHHFSGGK 1067 Query: 20 CSC 12 CSC Sbjct: 1068 CSC 1070 >ref|XP_002310674.1| predicted protein [Populus trichocarpa] gi|222853577|gb|EEE91124.1| predicted protein [Populus trichocarpa] Length = 908 Score = 119 bits (297), Expect = 3e-25 Identities = 52/66 (78%), Positives = 59/66 (89%) Frame = -3 Query: 200 ERLALAFSLIGTPEGSTIRIFKNLRVCGDCHSVYKFVSSVVQRKIVLRDPYRFHHFSGGN 21 ERLALA+ LI +PEGST++IFKNLRVCGDCHSVYKF S ++ RKIVLRDPYRFH FSGG Sbjct: 842 ERLALAYGLISSPEGSTLKIFKNLRVCGDCHSVYKFASGILGRKIVLRDPYRFHQFSGGQ 901 Query: 20 CSCSDY 3 CSC+DY Sbjct: 902 CSCTDY 907