BLASTX nr result
ID: Coptis21_contig00026244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00026244 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD71922.1| BAHD-type acyltransferase [Actaea racemosa] 59 4e-08 ref|XP_002511244.1| Anthranilate N-benzoyltransferase protein, p... 62 5e-08 >gb|ADD71922.1| BAHD-type acyltransferase [Actaea racemosa] Length = 424 Score = 59.3 bits (142), Expect(2) = 4e-08 Identities = 28/56 (50%), Positives = 42/56 (75%) Frame = -2 Query: 172 RVKCPLNEVLACPKAEKLNQLLPPEFHINATTEGLLDVKVNISECGGMAIGVSISH 5 RV CPL+++L CPKA++LNQL+P ++ L V+V++ +CGG+AIGV+ISH Sbjct: 98 RVPCPLSQLLGCPKADELNQLIP-------FSQKLSAVQVSLFDCGGIAIGVTISH 146 Score = 22.7 bits (47), Expect(2) = 4e-08 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 Query: 225 NQSIDCNDDDID 190 N+ IDCNDD ++ Sbjct: 82 NECIDCNDDGLE 93 >ref|XP_002511244.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus communis] gi|223550359|gb|EEF51846.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus communis] Length = 445 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 2/61 (3%) Frame = -2 Query: 181 WKLRVKCPLNEVLACPKAEKLNQLLPPEFHINATT--EGLLDVKVNISECGGMAIGVSIS 8 ++ RV CPL+E+L P+A+ LNQ LP E+H+ A + E + ++VN CGG+AIG SIS Sbjct: 99 FEARVNCPLSEILRRPEADVLNQFLPHEYHVPAASSMEFQVAIQVNTFTCGGIAIGTSIS 158 Query: 7 H 5 H Sbjct: 159 H 159