BLASTX nr result
ID: Coptis21_contig00026026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00026026 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532904.1| pentatricopeptide repeat-containing protein,... 122 3e-26 emb|CBI22269.3| unnamed protein product [Vitis vinifera] 117 7e-25 ref|XP_002278886.1| PREDICTED: pentatricopeptide repeat-containi... 117 7e-25 ref|XP_003552546.1| PREDICTED: pentatricopeptide repeat-containi... 112 3e-23 ref|XP_003530418.1| PREDICTED: pentatricopeptide repeat-containi... 112 4e-23 >ref|XP_002532904.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527338|gb|EEF29484.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 604 Score = 122 bits (306), Expect = 3e-26 Identities = 58/95 (61%), Positives = 73/95 (76%) Frame = +2 Query: 71 KMSNAIGTPTCVSRKTILEEKIPTLHKCSNLNHVKQIQAQIFKFNLHQDPFIAPKLIAAF 250 +MS PT VS + + EEK+ LHKC++ NH+K++ AQI K NLH D ++APKLI+AF Sbjct: 6 RMSLPTRAPTWVSTRRLFEEKLQDLHKCTDFNHIKEVHAQIIKRNLHNDLYVAPKLISAF 65 Query: 251 SLCNQLNLAVNVFYLIQKPNVFLYNTLIRAYTQNS 355 SLC+Q+NLAVNVF IQ PNV LYNTLIRA+ QNS Sbjct: 66 SLCHQMNLAVNVFNQIQDPNVHLYNTLIRAHVQNS 100 >emb|CBI22269.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 117 bits (294), Expect = 7e-25 Identities = 58/94 (61%), Positives = 72/94 (76%) Frame = +2 Query: 74 MSNAIGTPTCVSRKTILEEKIPTLHKCSNLNHVKQIQAQIFKFNLHQDPFIAPKLIAAFS 253 MS I PT VS++ +LE+KI LH+CS+LN VKQI AQ+ K NLH++ F+ KLIAAFS Sbjct: 1 MSVPIRNPTWVSKRRLLEQKISDLHRCSSLNQVKQIHAQVLKANLHRESFVGQKLIAAFS 60 Query: 254 LCNQLNLAVNVFYLIQKPNVFLYNTLIRAYTQNS 355 LC Q+ LAVNVF IQ P+V LYNTLIRA+ +NS Sbjct: 61 LCRQMTLAVNVFNQIQDPDVLLYNTLIRAHVRNS 94 >ref|XP_002278886.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Vitis vinifera] Length = 594 Score = 117 bits (294), Expect = 7e-25 Identities = 58/94 (61%), Positives = 72/94 (76%) Frame = +2 Query: 74 MSNAIGTPTCVSRKTILEEKIPTLHKCSNLNHVKQIQAQIFKFNLHQDPFIAPKLIAAFS 253 MS I PT VS++ +LE+KI LH+CS+LN VKQI AQ+ K NLH++ F+ KLIAAFS Sbjct: 1 MSVPIRNPTWVSKRRLLEQKISDLHRCSSLNQVKQIHAQVLKANLHRESFVGQKLIAAFS 60 Query: 254 LCNQLNLAVNVFYLIQKPNVFLYNTLIRAYTQNS 355 LC Q+ LAVNVF IQ P+V LYNTLIRA+ +NS Sbjct: 61 LCRQMTLAVNVFNQIQDPDVLLYNTLIRAHVRNS 94 >ref|XP_003552546.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Glycine max] Length = 604 Score = 112 bits (280), Expect = 3e-23 Identities = 55/89 (61%), Positives = 66/89 (74%) Frame = +2 Query: 95 PTCVSRKTILEEKIPTLHKCSNLNHVKQIQAQIFKFNLHQDPFIAPKLIAAFSLCNQLNL 274 PT SR+ +LEEK+ LHKC+NL+ V QI AQ+ K NLHQD F+APKLIAAFSLC L Sbjct: 12 PTWFSRRRLLEEKLCDLHKCTNLDSVNQIHAQVLKANLHQDLFVAPKLIAAFSLCRHLAS 71 Query: 275 AVNVFYLIQKPNVFLYNTLIRAYTQNSLH 361 AVNVF + PNV LYN++IRA+ NS H Sbjct: 72 AVNVFNHVPHPNVHLYNSIIRAHAHNSSH 100 >ref|XP_003530418.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Glycine max] Length = 604 Score = 112 bits (279), Expect = 4e-23 Identities = 55/89 (61%), Positives = 66/89 (74%) Frame = +2 Query: 95 PTCVSRKTILEEKIPTLHKCSNLNHVKQIQAQIFKFNLHQDPFIAPKLIAAFSLCNQLNL 274 PT SR+ +LEEK+ LHKCSNL+ V QI AQ+ K NLHQD F+APKLIAAFSLC L Sbjct: 12 PTWFSRQRLLEEKLCDLHKCSNLDSVNQIHAQVLKANLHQDLFVAPKLIAAFSLCRHLAS 71 Query: 275 AVNVFYLIQKPNVFLYNTLIRAYTQNSLH 361 AVNVF + PNV LYN++IRA+ N+ H Sbjct: 72 AVNVFNHVPHPNVHLYNSIIRAHAHNTSH 100