BLASTX nr result
ID: Coptis21_contig00025636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00025636 (1151 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32203.3| unnamed protein product [Vitis vinifera] 79 2e-12 ref|YP_001312257.1| hypothetical protein CYtaCp092 [Cycas taitun... 71 6e-10 ref|YP_001152246.1| ORF67g [Pinus koraiensis] gi|145048871|gb|AB... 58 4e-06 >emb|CBI32203.3| unnamed protein product [Vitis vinifera] Length = 83 Score = 79.3 bits (194), Expect = 2e-12 Identities = 38/43 (88%), Positives = 38/43 (88%) Frame = +1 Query: 127 FVDKADSELSFIPRHNLYPCASYSPGGCS*KYIHFYPLTSIPR 255 FVDKADSELSFIPRHNLYPCASYSPG S KY H YPLTSIPR Sbjct: 13 FVDKADSELSFIPRHNLYPCASYSPGVRSQKYSHPYPLTSIPR 55 >ref|YP_001312257.1| hypothetical protein CYtaCp092 [Cycas taitungensis] gi|150251549|ref|YP_001312281.1| hypothetical protein CYtaCp116 [Cycas taitungensis] gi|452848926|ref|YP_007474604.1| hypothetical_protein (chloroplast) [Cycas revoluta] gi|452849009|ref|YP_007474688.1| hypothetical_protein (chloroplast) [Cycas revoluta] gi|149941575|dbj|BAF64999.1| hypothetical protein (chloroplast) [Cycas taitungensis] gi|149941599|dbj|BAF65023.1| hypothetical protein (chloroplast) [Cycas taitungensis] gi|372863081|gb|AEX99154.1| hypothetical_protein (chloroplast) [Cycas revoluta] gi|372863164|gb|AEX99237.1| hypothetical_protein (chloroplast) [Cycas revoluta] Length = 67 Score = 70.9 bits (172), Expect = 6e-10 Identities = 36/48 (75%), Positives = 38/48 (79%) Frame = +1 Query: 127 FVDKADSELSFIPRHNLYPCASYSPGGCS*KYIHFYPLTSIPRASYPF 270 FVDKADSEL FIPRHNLYP ASY PG S +Y H YPL SIPRASY + Sbjct: 13 FVDKADSELFFIPRHNLYPFASYQPGVHS-QYSHPYPLMSIPRASYDY 59 >ref|YP_001152246.1| ORF67g [Pinus koraiensis] gi|145048871|gb|ABP35486.1| ORF67g [Pinus koraiensis] Length = 67 Score = 58.2 bits (139), Expect = 4e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 408 MEAGKGYNSAIECHLDVVEVISLSLIIPKSNASFSI 301 M GKGYNSA+ECHLD+VEVIS SLIIPK N S SI Sbjct: 1 MRVGKGYNSAVECHLDMVEVISSSLIIPKPNVSPSI 36