BLASTX nr result
ID: Coptis21_contig00025406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00025406 (189 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323259.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_002279516.2| PREDICTED: mitochondria fission 1 protein [V... 63 3e-08 ref|XP_002529168.1| conserved hypothetical protein [Ricinus comm... 63 3e-08 emb|CBI24220.3| unnamed protein product [Vitis vinifera] 63 3e-08 ref|XP_003632733.1| PREDICTED: mitochondria fission 1 protein-li... 62 5e-08 >ref|XP_002323259.1| predicted protein [Populus trichocarpa] gi|222867889|gb|EEF05020.1| predicted protein [Populus trichocarpa] Length = 167 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -3 Query: 127 SLVNLGSPLQKREKLYLLAVGNFRSGDYSRSRQLLEQSLEIA 2 SL N SPLQ+REK+YLLAVG +RSG+YSRSRQL++Q LEIA Sbjct: 79 SLANSSSPLQQREKIYLLAVGYYRSGEYSRSRQLVDQCLEIA 120 >ref|XP_002279516.2| PREDICTED: mitochondria fission 1 protein [Vitis vinifera] Length = 175 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -3 Query: 127 SLVNLGSPLQKREKLYLLAVGNFRSGDYSRSRQLLEQSLEIA 2 SL SPLQKREK+YL+AVG +RSGDYSRSRQL+E LEIA Sbjct: 79 SLAGTNSPLQKREKMYLIAVGYYRSGDYSRSRQLVECCLEIA 120 >ref|XP_002529168.1| conserved hypothetical protein [Ricinus communis] gi|223531392|gb|EEF33227.1| conserved hypothetical protein [Ricinus communis] Length = 103 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 127 SLVNLGSPLQKREKLYLLAVGNFRSGDYSRSRQLLEQSLEIA 2 SL N SPLQ+REK+YLLAVG +RSGDYSRSRQL+EQ L +A Sbjct: 15 SLGNSSSPLQQREKVYLLAVGYYRSGDYSRSRQLVEQCLAVA 56 >emb|CBI24220.3| unnamed protein product [Vitis vinifera] Length = 167 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -3 Query: 127 SLVNLGSPLQKREKLYLLAVGNFRSGDYSRSRQLLEQSLEIA 2 SL SPLQKREK+YL+AVG +RSGDYSRSRQL+E LEIA Sbjct: 79 SLAGTNSPLQKREKMYLIAVGYYRSGDYSRSRQLVECCLEIA 120 >ref|XP_003632733.1| PREDICTED: mitochondria fission 1 protein-like [Vitis vinifera] gi|297739910|emb|CBI30092.3| unnamed protein product [Vitis vinifera] Length = 167 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 127 SLVNLGSPLQKREKLYLLAVGNFRSGDYSRSRQLLEQSLEIA 2 SL + SPLQK+EKLYLLAVG +RSG+Y +SRQL+EQ LEIA Sbjct: 79 SLTSSSSPLQKKEKLYLLAVGYYRSGEYGKSRQLVEQCLEIA 120