BLASTX nr result
ID: Coptis21_contig00025092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00025092 (416 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517888.1| protein binding protein, putative [Ricinus c... 72 4e-11 ref|NP_194566.3| RING/U-box domain-containing protein [Arabidops... 71 1e-10 ref|NP_179657.2| RING/U-box domain-containing protein [Arabidops... 70 1e-10 gb|AAM15208.1| hypothetical protein [Arabidopsis thaliana] gi|20... 70 1e-10 ref|XP_002869508.1| zinc ion binding protein [Arabidopsis lyrata... 70 2e-10 >ref|XP_002517888.1| protein binding protein, putative [Ricinus communis] gi|223542870|gb|EEF44406.1| protein binding protein, putative [Ricinus communis] Length = 570 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/61 (55%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Frame = -2 Query: 181 LWPCFVFYLFQFVYAVRPLRETSQSWGDEWLFAKRDD-VVGPSAAWNITGTYRGTWNSQN 5 LW F F + + V VRPL+E ++SWGDEWLF K+D+ +GP +AWNITGTYRG+W + Sbjct: 28 LW--FGFVVLRPVAGVRPLKERARSWGDEWLFVKKDENDLGPFSAWNITGTYRGSWKFLD 85 Query: 4 S 2 S Sbjct: 86 S 86 >ref|NP_194566.3| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|56236078|gb|AAV84495.1| At4g28370 [Arabidopsis thaliana] gi|332660075|gb|AEE85475.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 562 Score = 70.9 bits (172), Expect = 1e-10 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -2 Query: 187 LMLWPCFVFYLFQFVYAVRPLRETSQSWGDEWLFAKRDDV-VGPSAAWNITGTYRGTWNS 11 ++LW + Q +RP+RE +SW DEWLF ++ + VGP +AWNITGTYRGTW Sbjct: 16 IILWLSIWLAISQQALGLRPIREKPRSWSDEWLFGRKQEAEVGPFSAWNITGTYRGTWKF 75 Query: 10 QNS 2 NS Sbjct: 76 LNS 78 >ref|NP_179657.2| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|42570835|ref|NP_973491.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|63147406|gb|AAY34176.1| At2g20650 [Arabidopsis thaliana] gi|330251958|gb|AEC07052.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|330251959|gb|AEC07053.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 559 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = -2 Query: 187 LMLWPCFVFYLFQFVYAVRPLRETSQSWGDEWLFAKRD-DVVGPSAAWNITGTYRGTW 17 L +W F + Q +RP+RET++SWGDEWLF K++ GP +AWNITGTYRGTW Sbjct: 17 LSIW----FAVLQQANGLRPIRETARSWGDEWLFGKKEKGGAGPFSAWNITGTYRGTW 70 >gb|AAM15208.1| hypothetical protein [Arabidopsis thaliana] gi|20198037|gb|AAD21704.2| hypothetical protein [Arabidopsis thaliana] Length = 515 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = -2 Query: 187 LMLWPCFVFYLFQFVYAVRPLRETSQSWGDEWLFAKRD-DVVGPSAAWNITGTYRGTW 17 L +W F + Q +RP+RET++SWGDEWLF K++ GP +AWNITGTYRGTW Sbjct: 17 LSIW----FAVLQQANGLRPIRETARSWGDEWLFGKKEKGGAGPFSAWNITGTYRGTW 70 >ref|XP_002869508.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] gi|297315344|gb|EFH45767.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] Length = 561 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/63 (47%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -2 Query: 187 LMLWPCFVFYLFQFVYAVRPLRETSQSWGDEWLFAKRDDV-VGPSAAWNITGTYRGTWNS 11 ++ W + Q +RP+RE ++SW DEWLF ++ + VGP +AWNITGTYRGTW Sbjct: 15 VIFWLSIWLAISQQALGLRPIREKTRSWSDEWLFGRKQEAEVGPFSAWNITGTYRGTWKF 74 Query: 10 QNS 2 NS Sbjct: 75 LNS 77