BLASTX nr result
ID: Coptis21_contig00025044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00025044 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_671862.1| pentatricopeptide repeat-containing protein [Ar... 97 1e-18 ref|XP_002884065.1| hypothetical protein ARALYDRAFT_343373 [Arab... 97 1e-18 gb|AAO72718.1| pentatricopeptide repeat-containing protein [Arab... 97 1e-18 ref|XP_003612374.1| Pentatricopeptide repeat-containing protein ... 97 2e-18 ref|XP_002521729.1| pentatricopeptide repeat-containing protein,... 96 3e-18 >ref|NP_671862.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546776|sp|Q84VG6.2|PP160_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g17525, mitochondrial; Flags: Precursor gi|330251547|gb|AEC06641.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 626 Score = 97.1 bits (240), Expect = 1e-18 Identities = 47/79 (59%), Positives = 58/79 (73%) Frame = +2 Query: 2 GNVGKGKSLMSEMVEPNEVTYNILISAYCREGNLIQAXXXXXXXXXXXXXPDVITITKVV 181 G VG+ +SLMSEM EPN+VT+NILISAYC E LIQ+ PDV+T+TKV+ Sbjct: 231 GKVGRARSLMSEMKEPNDVTFNILISAYCNEQKLIQSMVLLEKCFSLGFVPDVVTVTKVM 290 Query: 182 ELLCNKGRAKEAVEVLERV 238 E+LCN+GR EA+EVLERV Sbjct: 291 EVLCNEGRVSEALEVLERV 309 >ref|XP_002884065.1| hypothetical protein ARALYDRAFT_343373 [Arabidopsis lyrata subsp. lyrata] gi|297329905|gb|EFH60324.1| hypothetical protein ARALYDRAFT_343373 [Arabidopsis lyrata subsp. lyrata] Length = 1056 Score = 97.1 bits (240), Expect = 1e-18 Identities = 47/79 (59%), Positives = 58/79 (73%) Frame = +2 Query: 2 GNVGKGKSLMSEMVEPNEVTYNILISAYCREGNLIQAXXXXXXXXXXXXXPDVITITKVV 181 G VG+ +SLMSEM EPN+VT+NILISAYC E LIQ+ PDV+T+TKV+ Sbjct: 219 GKVGRARSLMSEMKEPNDVTFNILISAYCNEQKLIQSMVLLEKCFSLGLVPDVVTVTKVM 278 Query: 182 ELLCNKGRAKEAVEVLERV 238 E+LCN+GR EA+EVLERV Sbjct: 279 EVLCNEGRVSEALEVLERV 297 >gb|AAO72718.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 532 Score = 97.1 bits (240), Expect = 1e-18 Identities = 47/79 (59%), Positives = 58/79 (73%) Frame = +2 Query: 2 GNVGKGKSLMSEMVEPNEVTYNILISAYCREGNLIQAXXXXXXXXXXXXXPDVITITKVV 181 G VG+ +SLMSEM EPN+VT+NILISAYC E LIQ+ PDV+T+TKV+ Sbjct: 130 GKVGRARSLMSEMKEPNDVTFNILISAYCNEQKLIQSMVLLEKCFSLGFVPDVVTVTKVM 189 Query: 182 ELLCNKGRAKEAVEVLERV 238 E+LCN+GR EA+EVLERV Sbjct: 190 EVLCNEGRVSEALEVLERV 208 >ref|XP_003612374.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355513709|gb|AES95332.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 620 Score = 96.7 bits (239), Expect = 2e-18 Identities = 47/79 (59%), Positives = 58/79 (73%) Frame = +2 Query: 2 GNVGKGKSLMSEMVEPNEVTYNILISAYCREGNLIQAXXXXXXXXXXXXXPDVITITKVV 181 G VG+ +SLM+EMV+PNEVT+NILIS+Y +E NL+QA PDV+T+TKVV Sbjct: 226 GKVGRARSLMNEMVDPNEVTFNILISSYYKEENLVQALVLLEKCFALSLVPDVVTVTKVV 285 Query: 182 ELLCNKGRAKEAVEVLERV 238 E+LCN GR EA EVLERV Sbjct: 286 EILCNAGRVTEAAEVLERV 304 >ref|XP_002521729.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539120|gb|EEF40716.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 629 Score = 95.9 bits (237), Expect = 3e-18 Identities = 45/79 (56%), Positives = 58/79 (73%) Frame = +2 Query: 2 GNVGKGKSLMSEMVEPNEVTYNILISAYCREGNLIQAXXXXXXXXXXXXXPDVITITKVV 181 G VG+ +SLM E+ EPN+VT+N+LI+AYC+E NL+QA PDV+T+TKVV Sbjct: 227 GKVGRARSLMDEIEEPNDVTFNVLIAAYCKEENLVQALVLLEKSFSLGFVPDVVTMTKVV 286 Query: 182 ELLCNKGRAKEAVEVLERV 238 E+LCN GR EAVE+LERV Sbjct: 287 EILCNAGRVTEAVEMLERV 305