BLASTX nr result
ID: Coptis21_contig00024291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00024291 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275090.1| PREDICTED: probable anion transporter 2, chl... 57 1e-06 >ref|XP_002275090.1| PREDICTED: probable anion transporter 2, chloroplastic-like [Vitis vinifera] Length = 615 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/85 (31%), Positives = 53/85 (62%), Gaps = 8/85 (9%) Frame = -2 Query: 232 ECFLSSDTFSATWAEPRRMDKLGIYGTQWQQIEYLKATKTRTNYKAEPYDIEGPNLDSIE 53 +C+LSS+ ++W +P + +LGI +Q Q E+++ +TR+ YK++ YDI+G ++DS++ Sbjct: 118 KCYLSSNPSLSSWIQPSKRARLGISDSQSQSSEHVRFGRTRSAYKSKEYDIKGADVDSLK 177 Query: 52 FSE--------VPDVEKTSSWQEKF 2 SE +++ S W ++F Sbjct: 178 SSEGAGEVILAEENLQSVSPWWQQF 202