BLASTX nr result
ID: Coptis21_contig00024194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00024194 (843 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD32264.2| RNA-directed DNA polymerase , putative [Medicago ... 54 5e-06 >gb|ABD32264.2| RNA-directed DNA polymerase , putative [Medicago truncatula] Length = 161 Score = 53.9 bits (128), Expect(2) = 5e-06 Identities = 20/48 (41%), Positives = 34/48 (70%), Gaps = 2/48 (4%) Frame = -1 Query: 315 ILIYKWPSAVIK--EGIMRNFVWTGNPLTKRATTVSWKKWCTPVDEGG 178 I +Y WP++++K E ++NF+W+G+ ++ TV+WKK C P D+GG Sbjct: 92 ITVYNWPTSLLKDLEKSIKNFIWSGDTSKRKLVTVAWKKLCRPFDQGG 139 Score = 23.1 bits (48), Expect(2) = 5e-06 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 182 GVRFRRLKELNVVLLMKLVWHI 117 G+R R L +LN +KL W+I Sbjct: 139 GLRIRSLIQLNSASNLKLCWNI 160