BLASTX nr result
ID: Coptis21_contig00023435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00023435 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34813.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|XP_002281296.1| PREDICTED: putative DNA-binding protein ESCA... 70 2e-10 ref|XP_002279636.1| PREDICTED: putative DNA-binding protein ESCA... 68 7e-10 ref|XP_002511734.1| ESC, putative [Ricinus communis] gi|22354891... 64 2e-08 ref|XP_002299584.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 >emb|CBI34813.3| unnamed protein product [Vitis vinifera] Length = 240 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 269 LMSDPNAPLFQGLPPNLLNSCQLPTEAYWATGRSPY 162 L++DPNAPLF GLPPNLLNS QLP EAYWATGR PY Sbjct: 205 LLADPNAPLFHGLPPNLLNSIQLPAEAYWATGRPPY 240 >ref|XP_002281296.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Vitis vinifera] Length = 302 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 269 LMSDPNAPLFQGLPPNLLNSCQLPTEAYWATGRSPY 162 L++DPNAPLF GLPPNLLNS QLP EAYWATGR PY Sbjct: 267 LLADPNAPLFHGLPPNLLNSIQLPAEAYWATGRPPY 302 >ref|XP_002279636.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera] gi|147867329|emb|CAN81187.1| hypothetical protein VITISV_029906 [Vitis vinifera] gi|296089162|emb|CBI38865.3| unnamed protein product [Vitis vinifera] Length = 300 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 269 LMSDPNAPLFQGLPPNLLNSCQLPTEAYWATGRSPY 162 L+ DPNA LFQGLPPNLLNSCQLP EAYW T R PY Sbjct: 265 LLPDPNASLFQGLPPNLLNSCQLPAEAYWGTARPPY 300 >ref|XP_002511734.1| ESC, putative [Ricinus communis] gi|223548914|gb|EEF50403.1| ESC, putative [Ricinus communis] Length = 299 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -3 Query: 269 LMSDPNAPLFQGLPPNLLNSCQLPTEAYWATGRSPY 162 LM DPN PLFQGLPPNLLNS QLP EAYW R P+ Sbjct: 264 LMQDPNPPLFQGLPPNLLNSVQLPAEAYWGAARPPF 299 >ref|XP_002299584.1| predicted protein [Populus trichocarpa] gi|222846842|gb|EEE84389.1| predicted protein [Populus trichocarpa] Length = 302 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 269 LMSDPNAPLFQGLPPNLLNSCQLPTEAYWATGRSPY 162 +M++ NA LF GLPPNLLNS QLP EAYWATGR PY Sbjct: 267 VMAEQNAQLFHGLPPNLLNSIQLPAEAYWATGRPPY 302