BLASTX nr result
ID: Coptis21_contig00023384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00023384 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521489.1| conserved hypothetical protein [Ricinus comm... 73 2e-11 ref|XP_002282407.2| PREDICTED: uncharacterized protein LOC100243... 69 3e-10 emb|CBI22368.3| unnamed protein product [Vitis vinifera] 69 3e-10 emb|CBI15537.3| unnamed protein product [Vitis vinifera] 69 3e-10 emb|CBI16790.3| unnamed protein product [Vitis vinifera] 69 3e-10 >ref|XP_002521489.1| conserved hypothetical protein [Ricinus communis] gi|223539388|gb|EEF40979.1| conserved hypothetical protein [Ricinus communis] Length = 374 Score = 73.2 bits (178), Expect = 2e-11 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +1 Query: 1 PWEGVRDRCKKEWTMFQGRMINAEKKYYNDLGIEPPNSTIR 123 PWEGVR+RC+KEWTMFQ RM NAEK Y+ +GI PPNST R Sbjct: 334 PWEGVRERCRKEWTMFQDRMTNAEKAYFEAMGIHPPNSTTR 374 >ref|XP_002282407.2| PREDICTED: uncharacterized protein LOC100243914 [Vitis vinifera] Length = 491 Score = 69.3 bits (168), Expect = 3e-10 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 1 PWEGVRDRCKKEWTMFQGRMINAEKKYYNDLGIEPPNST 117 PW+GVR+RCKKEWTMF+ RM NAEK YY ++GI P NST Sbjct: 451 PWQGVRERCKKEWTMFRVRMTNAEKAYYKEMGINPTNST 489 >emb|CBI22368.3| unnamed protein product [Vitis vinifera] Length = 87 Score = 69.3 bits (168), Expect = 3e-10 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 1 PWEGVRDRCKKEWTMFQGRMINAEKKYYNDLGIEPPNST 117 PW+GVR+RCKKEWTMF+ RM NA+K YY D+GI P NST Sbjct: 47 PWQGVRERCKKEWTMFRVRMTNAKKAYYKDMGINPTNST 85 >emb|CBI15537.3| unnamed protein product [Vitis vinifera] Length = 87 Score = 69.3 bits (168), Expect = 3e-10 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 1 PWEGVRDRCKKEWTMFQGRMINAEKKYYNDLGIEPPNST 117 PW+GVR+RCKKEWTMF+ RM NAEK YY ++GI P NST Sbjct: 47 PWQGVRERCKKEWTMFRVRMTNAEKTYYKEMGINPTNST 85 >emb|CBI16790.3| unnamed protein product [Vitis vinifera] Length = 385 Score = 69.3 bits (168), Expect = 3e-10 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 1 PWEGVRDRCKKEWTMFQGRMINAEKKYYNDLGIEPPNST 117 PW+GVR+RCKKEWTMF+ RM NAEK YY ++GI P NST Sbjct: 345 PWQGVRERCKKEWTMFRVRMTNAEKAYYKEMGINPTNST 383