BLASTX nr result
ID: Coptis21_contig00023375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00023375 (448 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70291.1| hypothetical protein VITISV_019346 [Vitis vinifera] 69 3e-10 >emb|CAN70291.1| hypothetical protein VITISV_019346 [Vitis vinifera] Length = 494 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/52 (63%), Positives = 37/52 (71%) Frame = +2 Query: 137 GKGQGCISGMCSFANIVSPLTFTPLTDGSLCTEYYHKSCYSNFKQQNQQQHL 292 GK QGCISG+ S A I+SPL F+PLTD L +EYY K C S FK NQQQ L Sbjct: 428 GKAQGCISGISSSAQIISPLIFSPLTDDRLHSEYYDKGCSSYFKSANQQQQL 479