BLASTX nr result
ID: Coptis21_contig00023142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00023142 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003077950.1| U2 snRNP auxiliary factor, large subunit (IS... 54 1e-05 >ref|XP_003077950.1| U2 snRNP auxiliary factor, large subunit (ISS) [Ostreococcus tauri] gi|116056401|emb|CAL52690.1| U2 snRNP auxiliary factor, large subunit (ISS) [Ostreococcus tauri] Length = 388 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/57 (45%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +3 Query: 36 TSQVSGHARRFCIGDLPSDANEQEILNLFQDKIKSVGG-SNHSAVILNVYINRRKKY 203 T+Q + HARR +G P+ ANEQE+ + F D + +VGG ++ A ++NVYIN KK+ Sbjct: 50 TAQTTRHARRIYLGGCPTMANEQELSSFFNDALVAVGGTTSEEAPVVNVYINLEKKF 106