BLASTX nr result
ID: Coptis21_contig00023017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00023017 (462 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulg... 88 1e-17 >ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435151|ref|YP_004222369.1| hypothetical protein BevumaM_p136 [Beta vulgaris subsp. maritima] gi|346683242|ref|YP_004842174.1| hypothetical protein BemaM_p130 [Beta macrocarpa] gi|9049306|dbj|BAA99316.1| orf107b [Beta vulgaris subsp. vulgaris] gi|317905601|emb|CBJ14008.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439884|emb|CBJ17584.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148038|emb|CBJ20702.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500160|emb|CBX24979.1| hypothetical protein [Beta macrocarpa] gi|384977914|emb|CBL54138.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 107 Score = 87.8 bits (216), Expect(2) = 1e-17 Identities = 44/68 (64%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Frame = -2 Query: 461 PNHHTKRIDANPPRYRTCDSHRIRLAQRLLNPSRAF-FXXXXXXXXXXXXXPGAMRGMLP 285 PNHHT RIDANPPRYRTCDSHRIRLAQRLLNPSRAF + G+ P Sbjct: 18 PNHHTTRIDANPPRYRTCDSHRIRLAQRLLNPSRAFSSTFPLQSSIKLAFSRRSEMGVFP 77 Query: 284 SPIICIGL 261 SPI+CIGL Sbjct: 78 SPIVCIGL 85 Score = 26.6 bits (57), Expect(2) = 1e-17 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 259 LASSRTKEEFWRARACRNADY 197 LASSR+K + RARACR AD+ Sbjct: 85 LASSRSKL-YLRARACRKADH 104