BLASTX nr result
ID: Coptis21_contig00022384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00022384 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004150723.1| PREDICTED: bidirectional sugar transporter S... 68 5e-11 ref|XP_002526178.1| conserved hypothetical protein [Ricinus comm... 62 3e-09 ref|XP_003523404.1| PREDICTED: bidirectional sugar transporter S... 62 6e-09 ref|XP_003526670.1| PREDICTED: bidirectional sugar transporter S... 62 7e-09 gb|EAY76715.1| hypothetical protein OsI_04670 [Oryza sativa Indi... 61 3e-08 >ref|XP_004150723.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Cucumis sativus] gi|449521263|ref|XP_004167649.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Cucumis sativus] Length = 252 Score = 68.2 bits (165), Expect(2) = 5e-11 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +2 Query: 95 GLPFVSPHNILVSTINFTGATIESIYAVIFIIYVPRKVKEKMG 223 GLPFVSPHNILVSTIN TGA IE IY ++FIIY P+K K K+G Sbjct: 58 GLPFVSPHNILVSTINGTGAVIELIYVMVFIIYAPKKEKGKIG 100 Score = 23.9 bits (50), Expect(2) = 5e-11 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +1 Query: 274 IFTLDGQTRKLFC 312 +F L+G+ RKLFC Sbjct: 118 VFALEGKIRKLFC 130 >ref|XP_002526178.1| conserved hypothetical protein [Ricinus communis] gi|223534555|gb|EEF36254.1| conserved hypothetical protein [Ricinus communis] Length = 248 Score = 61.6 bits (148), Expect(2) = 3e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 95 GLPFVSPHNILVSTINFTGATIESIYAVIFIIYVPRKVKEKM 220 GLPFVS +N+LVSTIN TGA IE+IY +IFIIY PR+ K K+ Sbjct: 58 GLPFVSKNNLLVSTINGTGAVIETIYVLIFIIYAPRREKSKI 99 Score = 24.3 bits (51), Expect(2) = 3e-09 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +1 Query: 274 IFTLDGQTRKLFC 312 +F L G TRKLFC Sbjct: 118 LFALHGSTRKLFC 130 >ref|XP_003523404.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Glycine max] Length = 247 Score = 62.4 bits (150), Expect(2) = 6e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 95 GLPFVSPHNILVSTINFTGATIESIYAVIFIIYVPRKVKEKM 220 GLPFVSPHNILVST+N TG+ IE IY +IFI+ PRK K K+ Sbjct: 58 GLPFVSPHNILVSTVNGTGSLIEIIYVLIFIVLAPRKEKAKI 99 Score = 22.7 bits (47), Expect(2) = 6e-09 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 274 IFTLDGQTRKLFC 312 +F L G +RKLFC Sbjct: 118 LFALHGNSRKLFC 130 >ref|XP_003526670.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Glycine max] Length = 247 Score = 62.0 bits (149), Expect(2) = 7e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 95 GLPFVSPHNILVSTINFTGATIESIYAVIFIIYVPRKVKEKM 220 GLPFVSPHNILVST+N TG+ IE IY +IFI+ PRK K K+ Sbjct: 58 GLPFVSPHNILVSTVNGTGSFIEIIYVLIFIVLAPRKEKAKI 99 Score = 22.7 bits (47), Expect(2) = 7e-09 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 274 IFTLDGQTRKLFC 312 +F L G +RKLFC Sbjct: 118 LFALHGNSRKLFC 130 >gb|EAY76715.1| hypothetical protein OsI_04670 [Oryza sativa Indica Group] Length = 314 Score = 61.2 bits (147), Expect(2) = 3e-08 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +2 Query: 89 RCGLPFVSPHNILVSTINFTGATIESIYAVIFIIYVPRKVKEKM 220 R GLPFVSP+NILV+TIN TG+ IE+IY VIF+I+ RK + KM Sbjct: 96 RYGLPFVSPNNILVTTINGTGSVIEAIYVVIFLIFAERKARLKM 139 Score = 21.2 bits (43), Expect(2) = 3e-08 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 274 IFTLDGQTRKLFC 312 + L GQ RKLFC Sbjct: 158 LLALHGQGRKLFC 170