BLASTX nr result
ID: Coptis21_contig00022355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00022355 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522838.1| pentatricopeptide repeat-containing protein,... 60 2e-07 ref|XP_002279701.2| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_003541878.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 emb|CBI20513.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_003539564.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 >ref|XP_002522838.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537922|gb|EEF39536.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 867 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/54 (55%), Positives = 38/54 (70%) Frame = +1 Query: 127 IMQVHAALAIIDQMCQLGLALSFSAVFPILHAIEESSEFDLVHPIYSVIRRHNL 288 +++VHAAL I+DQMC+ L LS + IL A EES EF+LV IYS+I HNL Sbjct: 440 LLKVHAALDIVDQMCKADLTLSIDVLNSILRACEESFEFNLVQQIYSLICHHNL 493 >ref|XP_002279701.2| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Vitis vinifera] Length = 848 Score = 59.7 bits (143), Expect = 2e-07 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = +1 Query: 133 QVHAALAIIDQMCQLGLALSFSAVFPILHAIEESSEFDLVHPIYSVIRRHNL 288 +VHAAL I+DQMC+ GL LS IL A EES EF+LVH IYSVI +L Sbjct: 413 KVHAALDIVDQMCEAGLTLSIEMFHSILRASEESFEFNLVHRIYSVICHQSL 464 >ref|XP_003541878.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21880, mitochondrial-like [Glycine max] Length = 705 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/54 (48%), Positives = 40/54 (74%) Frame = +1 Query: 127 IMQVHAALAIIDQMCQLGLALSFSAVFPILHAIEESSEFDLVHPIYSVIRRHNL 288 +++VH AL I+D+MC+ GL LS A+ IL +++SE++LVH I+S IR +NL Sbjct: 351 LLEVHVALDIVDEMCEAGLTLSTKALHSILQICDDTSEYNLVHRIFSTIRHYNL 404 >emb|CBI20513.3| unnamed protein product [Vitis vinifera] Length = 618 Score = 59.7 bits (143), Expect = 2e-07 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = +1 Query: 133 QVHAALAIIDQMCQLGLALSFSAVFPILHAIEESSEFDLVHPIYSVIRRHNL 288 +VHAAL I+DQMC+ GL LS IL A EES EF+LVH IYSVI +L Sbjct: 183 KVHAALDIVDQMCEAGLTLSIEMFHSILRASEESFEFNLVHRIYSVICHQSL 234 >ref|XP_003539564.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial [Glycine max] Length = 755 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/54 (46%), Positives = 39/54 (72%) Frame = +1 Query: 127 IMQVHAALAIIDQMCQLGLALSFSAVFPILHAIEESSEFDLVHPIYSVIRRHNL 288 +++VH AL I+D+MC+ GL LS + IL +++SE++LVH I+S I R+NL Sbjct: 397 LLKVHVALDIVDEMCEAGLTLSTKVLHSILQICDDTSEYNLVHRIFSTIHRYNL 450