BLASTX nr result
ID: Coptis21_contig00022347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00022347 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512441.1| arginine/serine-rich splicing factor, putati... 105 5e-21 gb|ABR18062.1| unknown [Picea sitchensis] 105 5e-21 emb|CBI39508.3| unnamed protein product [Vitis vinifera] 104 7e-21 emb|CBI36847.3| unnamed protein product [Vitis vinifera] 104 7e-21 ref|XP_002283865.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 104 7e-21 >ref|XP_002512441.1| arginine/serine-rich splicing factor, putative [Ricinus communis] gi|223548402|gb|EEF49893.1| arginine/serine-rich splicing factor, putative [Ricinus communis] Length = 300 Score = 105 bits (261), Expect = 5e-21 Identities = 47/52 (90%), Positives = 52/52 (100%) Frame = +3 Query: 45 MSSKASRTLYVGNLPGDIREREVEDIFYKYGPIVEIDLKIPPRPPGYAFVEF 200 MSS+ASRTLYVGNLPGDIR+REV+D+FYKYGPIVE+DLKIPPRPPGYAFVEF Sbjct: 38 MSSRASRTLYVGNLPGDIRQREVKDLFYKYGPIVEVDLKIPPRPPGYAFVEF 89 >gb|ABR18062.1| unknown [Picea sitchensis] Length = 331 Score = 105 bits (261), Expect = 5e-21 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = +3 Query: 45 MSSKASRTLYVGNLPGDIREREVEDIFYKYGPIVEIDLKIPPRPPGYAFVEF 200 MSS+ASRTLYVGNLPGDIREREVED+FYKYGPIV+IDLKIPPRPPGY F+EF Sbjct: 1 MSSRASRTLYVGNLPGDIREREVEDLFYKYGPIVDIDLKIPPRPPGYCFIEF 52 >emb|CBI39508.3| unnamed protein product [Vitis vinifera] Length = 249 Score = 104 bits (260), Expect = 7e-21 Identities = 47/52 (90%), Positives = 52/52 (100%) Frame = +3 Query: 45 MSSKASRTLYVGNLPGDIREREVEDIFYKYGPIVEIDLKIPPRPPGYAFVEF 200 MSS++SRT+YVGNLPGDIREREVED+FYKYGPIV+IDLKIPPRPPGYAFVEF Sbjct: 1 MSSRSSRTVYVGNLPGDIREREVEDLFYKYGPIVDIDLKIPPRPPGYAFVEF 52 >emb|CBI36847.3| unnamed protein product [Vitis vinifera] Length = 264 Score = 104 bits (260), Expect = 7e-21 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +3 Query: 45 MSSKASRTLYVGNLPGDIREREVEDIFYKYGPIVEIDLKIPPRPPGYAFVEF 200 MSS+ASRTLYVGNLPGDIREREVED+FYKYGPI IDLKIPPRPPGYAFVEF Sbjct: 1 MSSRASRTLYVGNLPGDIREREVEDLFYKYGPIAHIDLKIPPRPPGYAFVEF 52 >ref|XP_002283865.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Vitis vinifera] Length = 288 Score = 104 bits (260), Expect = 7e-21 Identities = 47/52 (90%), Positives = 52/52 (100%) Frame = +3 Query: 45 MSSKASRTLYVGNLPGDIREREVEDIFYKYGPIVEIDLKIPPRPPGYAFVEF 200 MSS++SRT+YVGNLPGDIREREVED+FYKYGPIV+IDLKIPPRPPGYAFVEF Sbjct: 1 MSSRSSRTVYVGNLPGDIREREVEDLFYKYGPIVDIDLKIPPRPPGYAFVEF 52