BLASTX nr result
ID: Coptis21_contig00022206
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00022206 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003603726.1| Transmembrane and coiled-coil domain-contain... 57 2e-06 >ref|XP_003603726.1| Transmembrane and coiled-coil domain-containing protein [Medicago truncatula] gi|355492774|gb|AES73977.1| Transmembrane and coiled-coil domain-containing protein [Medicago truncatula] Length = 663 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 144 GAPISITDENWGIARKMVAGRFVNAYATSD 233 GAPISI DENW +ARKMVAGRFVNAY+T+D Sbjct: 557 GAPISIKDENWEVARKMVAGRFVNAYSTND 586