BLASTX nr result
ID: Coptis21_contig00021883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00021883 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003542095.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-18 ref|XP_003546486.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-18 gb|ACU23208.1| unknown [Glycine max] 74 2e-18 ref|XP_002300357.1| predicted protein [Populus trichocarpa] gi|2... 70 7e-18 ref|XP_002514778.1| pentatricopeptide repeat-containing protein,... 73 2e-17 >ref|XP_003542095.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Glycine max] Length = 539 Score = 74.3 bits (181), Expect(2) = 2e-18 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -3 Query: 132 VSEAKKKHAKLSPVMFHILARGYCELEEFDKALELLIEMKDYGV 1 ++EAKKKH KL PVMFH L RGYC+LE+FD+AL+LL EMKDYGV Sbjct: 430 LAEAKKKHVKLGPVMFHTLIRGYCKLEQFDEALKLLAEMKDYGV 473 Score = 42.7 bits (99), Expect(2) = 2e-18 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -2 Query: 217 ESRGLRPNVSTYSVLLSGYVKGGQMDEAR 131 ESRGLRP+V TY+VL S Y GG+M+EA+ Sbjct: 399 ESRGLRPDVYTYTVLASAYSNGGEMEEAQ 427 >ref|XP_003546486.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like isoform 1 [Glycine max] gi|356556346|ref|XP_003546487.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like isoform 2 [Glycine max] Length = 538 Score = 74.3 bits (181), Expect(2) = 2e-18 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -3 Query: 132 VSEAKKKHAKLSPVMFHILARGYCELEEFDKALELLIEMKDYGV 1 ++E KKKHAKL PVMFH L RGYC+LE+FD+AL+LL EMKDYGV Sbjct: 429 LAEVKKKHAKLGPVMFHTLIRGYCKLEQFDEALKLLAEMKDYGV 472 Score = 42.7 bits (99), Expect(2) = 2e-18 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -2 Query: 217 ESRGLRPNVSTYSVLLSGYVKGGQMDEAR 131 ESRGLRP+V TY+VL S Y GG+M+EA+ Sbjct: 398 ESRGLRPDVYTYTVLASAYSNGGEMEEAQ 426 >gb|ACU23208.1| unknown [Glycine max] Length = 177 Score = 74.3 bits (181), Expect(2) = 2e-18 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -3 Query: 132 VSEAKKKHAKLSPVMFHILARGYCELEEFDKALELLIEMKDYGV 1 ++E KKKHAKL PVMFH L RGYC+LE+FD+AL+LL EMKDYGV Sbjct: 68 LAEVKKKHAKLGPVMFHTLIRGYCKLEQFDEALKLLAEMKDYGV 111 Score = 42.7 bits (99), Expect(2) = 2e-18 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -2 Query: 217 ESRGLRPNVSTYSVLLSGYVKGGQMDEAR 131 ESRGLRP+V TY+VL S Y GG+M+EA+ Sbjct: 37 ESRGLRPDVYTYTVLASAYSNGGEMEEAQ 65 >ref|XP_002300357.1| predicted protein [Populus trichocarpa] gi|222847615|gb|EEE85162.1| predicted protein [Populus trichocarpa] Length = 476 Score = 70.1 bits (170), Expect(2) = 7e-18 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -3 Query: 132 VSEAKKKHAKLSPVMFHILARGYCELEEFDKALELLIEMKDYGV 1 +SEAKKKH+KLSPV +H L RGYC+L++FDKALELL EM+ +GV Sbjct: 368 LSEAKKKHSKLSPVTYHALIRGYCKLDQFDKALELLAEMEKFGV 411 Score = 45.1 bits (105), Expect(2) = 7e-18 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = -2 Query: 217 ESRGLRPNVSTYSVLLSGYVKGGQMDEA 134 ESRGL+P+V TY+V++SGY GGQM+EA Sbjct: 337 ESRGLKPDVYTYTVIISGYSNGGQMEEA 364 >ref|XP_002514778.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545829|gb|EEF47332.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 584 Score = 72.8 bits (177), Expect(2) = 2e-17 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -3 Query: 132 VSEAKKKHAKLSPVMFHILARGYCELEEFDKALELLIEMKDYGV 1 +SEAKKKH+KLSPVM+H + RGYC+LE+FDKAL+LL EMK +GV Sbjct: 476 LSEAKKKHSKLSPVMYHTVIRGYCKLEQFDKALDLLAEMKTFGV 519 Score = 41.2 bits (95), Expect(2) = 2e-17 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = -2 Query: 211 RGLRPNVSTYSVLLSGYVKGGQMDEA 134 RGL+P++ TY+V++SGY GGQM+EA Sbjct: 447 RGLKPDLFTYAVIMSGYASGGQMEEA 472