BLASTX nr result
ID: Coptis21_contig00021775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00021775 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61437.1| hypothetical protein VITISV_033770 [Vitis vinife... 55 8e-06 >emb|CAN61437.1| hypothetical protein VITISV_033770 [Vitis vinifera] gi|297738730|emb|CBI27975.3| unnamed protein product [Vitis vinifera] Length = 454 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +2 Query: 164 MDIQQLKSDHFSFVPFRKSFDEVRVEETTKGRDA-SPHTCQ 283 +DIQQLKSDHFSF PFRKSFDEV + E + R+A + TC+ Sbjct: 267 LDIQQLKSDHFSFAPFRKSFDEVGIGEASTAREAPASGTCE 307