BLASTX nr result
ID: Coptis21_contig00021565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00021565 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300539.1| predicted protein [Populus trichocarpa] gi|2... 119 3e-25 ref|XP_002263237.2| PREDICTED: subtilisin-like protease-like [Vi... 116 2e-24 emb|CBI37484.3| unnamed protein product [Vitis vinifera] 116 2e-24 ref|XP_002317030.1| predicted protein [Populus trichocarpa] gi|2... 116 2e-24 ref|XP_002528535.1| Cucumisin precursor, putative [Ricinus commu... 115 5e-24 >ref|XP_002300539.1| predicted protein [Populus trichocarpa] gi|222847797|gb|EEE85344.1| predicted protein [Populus trichocarpa] Length = 746 Score = 119 bits (298), Expect = 3e-25 Identities = 57/73 (78%), Positives = 63/73 (86%) Frame = +3 Query: 6 AAIKSAIMTTATTLGKSGRPITVDPKGRRGNPFDYGSGFVDPLKVLNPGLVYDAQPRDYK 185 +AIKSAIMTTAT L KSG+PI VDP+GR N FDYGSGFVDP +VL+PGLVYDA P DYK Sbjct: 550 SAIKSAIMTTATILDKSGKPIRVDPEGRMANAFDYGSGFVDPTRVLDPGLVYDAHPIDYK 609 Query: 186 AFLCSIGYDEELL 224 AFLCSIGYDE+ L Sbjct: 610 AFLCSIGYDEKSL 622 >ref|XP_002263237.2| PREDICTED: subtilisin-like protease-like [Vitis vinifera] Length = 763 Score = 116 bits (291), Expect = 2e-24 Identities = 54/73 (73%), Positives = 64/73 (87%) Frame = +3 Query: 6 AAIKSAIMTTATTLGKSGRPITVDPKGRRGNPFDYGSGFVDPLKVLNPGLVYDAQPRDYK 185 +AIKSAIMTTAT L K+ R ITVDP+GR+GN FDYGSGFV+P +VL+PGL+YD +P DYK Sbjct: 567 SAIKSAIMTTATILDKNRRSITVDPEGRKGNAFDYGSGFVNPTRVLDPGLIYDTEPTDYK 626 Query: 186 AFLCSIGYDEELL 224 AFLCSIGY E+LL Sbjct: 627 AFLCSIGYSEKLL 639 >emb|CBI37484.3| unnamed protein product [Vitis vinifera] Length = 764 Score = 116 bits (291), Expect = 2e-24 Identities = 54/73 (73%), Positives = 64/73 (87%) Frame = +3 Query: 6 AAIKSAIMTTATTLGKSGRPITVDPKGRRGNPFDYGSGFVDPLKVLNPGLVYDAQPRDYK 185 +AIKSAIMTTAT L K+ R ITVDP+GR+GN FDYGSGFV+P +VL+PGL+YD +P DYK Sbjct: 565 SAIKSAIMTTATILDKNRRSITVDPEGRKGNAFDYGSGFVNPTRVLDPGLIYDTEPTDYK 624 Query: 186 AFLCSIGYDEELL 224 AFLCSIGY E+LL Sbjct: 625 AFLCSIGYSEKLL 637 >ref|XP_002317030.1| predicted protein [Populus trichocarpa] gi|222860095|gb|EEE97642.1| predicted protein [Populus trichocarpa] Length = 726 Score = 116 bits (290), Expect = 2e-24 Identities = 55/73 (75%), Positives = 62/73 (84%) Frame = +3 Query: 6 AAIKSAIMTTATTLGKSGRPITVDPKGRRGNPFDYGSGFVDPLKVLNPGLVYDAQPRDYK 185 +AIKSAIMTTAT L K+ PI VDP+GRR N FDYGSGFVDP +VL+PGL+YDA P DYK Sbjct: 530 SAIKSAIMTTATILDKNDEPIRVDPEGRRANSFDYGSGFVDPSRVLDPGLIYDAHPIDYK 589 Query: 186 AFLCSIGYDEELL 224 AFLCSIGYDE+ L Sbjct: 590 AFLCSIGYDEKSL 602 >ref|XP_002528535.1| Cucumisin precursor, putative [Ricinus communis] gi|223532037|gb|EEF33847.1| Cucumisin precursor, putative [Ricinus communis] Length = 761 Score = 115 bits (287), Expect = 5e-24 Identities = 53/73 (72%), Positives = 64/73 (87%) Frame = +3 Query: 6 AAIKSAIMTTATTLGKSGRPITVDPKGRRGNPFDYGSGFVDPLKVLNPGLVYDAQPRDYK 185 +AIKSAIMTTAT L K+ +PITVDP+GRRGN FDYGSGFV+P +VL+PGL+YDA DYK Sbjct: 565 SAIKSAIMTTATILDKNRKPITVDPRGRRGNAFDYGSGFVNPTRVLDPGLIYDAYTTDYK 624 Query: 186 AFLCSIGYDEELL 224 +FLCSIGYD++ L Sbjct: 625 SFLCSIGYDDKSL 637