BLASTX nr result
ID: Coptis21_contig00021552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00021552 (800 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282417.1| PREDICTED: uncharacterized protein LOC100246... 58 3e-06 emb|CAN74978.1| hypothetical protein VITISV_027198 [Vitis vinifera] 58 3e-06 >ref|XP_002282417.1| PREDICTED: uncharacterized protein LOC100246918 [Vitis vinifera] Length = 604 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/60 (53%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +3 Query: 441 MTGGSLGQRASSYGSLQHLPNNSVVLPIYTTP-VVARKPPKMLLSNAREKEKILPRICKF 617 MTGG LG R+ SYGSLQHL N + + P V RKP KML S +REKE++LP + +F Sbjct: 1 MTGGLLGLRSGSYGSLQHLQNGA----FHPQPQFVGRKPSKMLPSGSREKERLLPYLFRF 56 >emb|CAN74978.1| hypothetical protein VITISV_027198 [Vitis vinifera] Length = 616 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/60 (53%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +3 Query: 441 MTGGSLGQRASSYGSLQHLPNNSVVLPIYTTP-VVARKPPKMLLSNAREKEKILPRICKF 617 MTGG LG R+ SYGSLQHL N + + P V RKP KML S +REKE++LP + +F Sbjct: 1 MTGGLLGLRSGSYGSLQHLQNGA----FHPQPQFVGRKPSKMLPSGSREKERLLPYLFRF 56