BLASTX nr result
ID: Coptis21_contig00020918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00020918 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAZ03964.1| Ycf3 [Ranunculus macranthus] 84 9e-15 ref|YP_007317249.1| photosystem I assembly protein Ycf3 (chlorop... 84 1e-14 ref|YP_636300.1| photosystem I assembly protein Ycf3 [Eucalyptus... 84 1e-14 ref|YP_086967.1| photosystem I assembly protein Ycf3 [Panax gins... 84 1e-14 gb|AFB70727.1| photosystem I assembly protein Ycf3, partial (chl... 84 1e-14 >gb|AAZ03964.1| Ycf3 [Ranunculus macranthus] Length = 170 Score = 84.3 bits (207), Expect = 9e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 98 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYKDAS 226 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYY+D + Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGA 43 >ref|YP_007317249.1| photosystem I assembly protein Ycf3 (chloroplast) [Camellia sinensis] gi|430728273|gb|AGA55597.1| photosystem I assembly protein Ycf3 (chloroplast) [Camellia sinensis] Length = 168 Score = 84.0 bits (206), Expect = 1e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 98 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYKD 220 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYY+D Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_636300.1| photosystem I assembly protein Ycf3 [Eucalyptus globulus subsp. globulus] gi|164597810|ref|NP_084670.3| photosystem I assembly protein Ycf3 [Oenothera elata subsp. hookeri] gi|169142700|ref|YP_001687127.1| photosystem I assembly protein Ycf3 [Oenothera argillicola] gi|169142850|ref|YP_001687273.1| photosystem I assembly protein Ycf3 [Oenothera glazioviana] gi|169142935|ref|YP_001687357.1| photosystem I assembly protein Ycf3 [Oenothera biennis] gi|169143021|ref|YP_001687441.1| photosystem I assembly protein Ycf3 [Oenothera parviflora] gi|309322450|ref|YP_003933963.1| hypothetical chloroplast RF34 [Eucalyptus grandis] gi|313199703|ref|YP_004021317.1| hypothetical chloroplast RF34 [Theobroma cacao] gi|122239624|sp|Q49KZ7.1|YCF3_EUCGG RecName: Full=Photosystem I assembly protein ycf3 gi|172045804|sp|Q9MTP0.3|YCF3_OENEH RecName: Full=Photosystem I assembly protein ycf3 gi|60460810|gb|AAX21030.1| ycf3 protein [Eucalyptus globulus subsp. globulus] gi|159792938|gb|ABW98694.1| photosystem I assembly protein Ycf3 [Oenothera argillicola] gi|159793108|gb|ABW98862.1| photosystem I assembly protein Ycf3 [Oenothera biennis] gi|159895462|gb|ABX10027.1| photosystem I assembly protein Ycf3 [Oenothera glazioviana] gi|159895547|gb|ABX10111.1| photosystem I assembly protein Ycf3 [Oenothera parviflora] gi|162423677|emb|CAB67135.2| photosystem I assembly protein Ycf3 [Oenothera elata subsp. hookeri] gi|290488970|gb|ADD30869.1| putative RF3 protein [Euonymus americanus] gi|308223284|gb|ADO23592.1| hypothetical chloroplast RF34 [Eucalyptus grandis] gi|309321267|gb|ADO64810.1| hypothetical chloroplast RF34 [Theobroma cacao] gi|328924784|gb|ADO64891.2| hypothetical chloroplast R34 [Theobroma cacao] gi|371925937|gb|AEX57727.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926019|gb|AEX57808.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926101|gb|AEX57889.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926183|gb|AEX57970.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926265|gb|AEX58051.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926347|gb|AEX58132.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926429|gb|AEX58213.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926511|gb|AEX58294.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926593|gb|AEX58375.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926675|gb|AEX58456.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma grandiflorum] gi|371926757|gb|AEX58537.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] Length = 168 Score = 84.0 bits (206), Expect = 1e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 98 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYKD 220 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYY+D Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_086967.1| photosystem I assembly protein Ycf3 [Panax ginseng] gi|359422145|ref|YP_004935553.1| photosystem I assembly protein Ycf3 (chloroplast) [Eleutherococcus senticosus] gi|68053100|sp|Q68S05.1|YCF3_PANGI RecName: Full=Photosystem I assembly protein ycf3 gi|51235314|gb|AAT98510.1| ycf3 protein [Panax ginseng] gi|347448208|gb|AEO92620.1| photosystem I assembly protein Ycf3 (chloroplast) [Eleutherococcus senticosus] Length = 168 Score = 84.0 bits (206), Expect = 1e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 98 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYKD 220 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYY+D Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >gb|AFB70727.1| photosystem I assembly protein Ycf3, partial (chloroplast) [Mollugo verticillata] Length = 217 Score = 84.0 bits (206), Expect = 1e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 98 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYKD 220 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYY+D Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41