BLASTX nr result
ID: Coptis21_contig00020779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00020779 (952 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317485.1| predicted protein [Populus trichocarpa] gi|2... 59 2e-06 >ref|XP_002317485.1| predicted protein [Populus trichocarpa] gi|222860550|gb|EEE98097.1| predicted protein [Populus trichocarpa] Length = 249 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/53 (56%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = +2 Query: 227 PVAPSQV-QHSDFEFGSSTSKIPINDPNKDTPADVLFHNGRLLPHSYQCPSQK 382 P PS + Q SDFEFG T P DPNK +PAD LF NGRLLPHS+ Q+ Sbjct: 35 PSTPSTLDQDSDFEFGCLTPDSPSRDPNKSSPADHLFFNGRLLPHSFPVLQQQ 87