BLASTX nr result
ID: Coptis21_contig00019979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00019979 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523203.1| PREDICTED: cyclin-dependent kinase E-1-like ... 75 5e-12 ref|XP_003602688.1| Cyclin-dependent kinase E-1 [Medicago trunca... 75 5e-12 ref|XP_004172297.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-depen... 75 7e-12 ref|XP_004144669.1| PREDICTED: cyclin-dependent kinase E-1-like ... 74 1e-11 ref|XP_002273171.1| PREDICTED: cyclin-dependent kinase E-1 [Viti... 74 1e-11 >ref|XP_003523203.1| PREDICTED: cyclin-dependent kinase E-1-like [Glycine max] Length = 462 Score = 75.1 bits (183), Expect = 5e-12 Identities = 38/43 (88%), Positives = 39/43 (90%), Gaps = 2/43 (4%) Frame = -2 Query: 125 PVWLQQYDLIGKIGEGTYGLVFLAKIKS--QRGKSIAIKKFKQ 3 P WLQQYDLIGKIGEGTYGLVFLA+IKS RGKSIAIKKFKQ Sbjct: 12 PEWLQQYDLIGKIGEGTYGLVFLARIKSSTNRGKSIAIKKFKQ 54 >ref|XP_003602688.1| Cyclin-dependent kinase E-1 [Medicago truncatula] gi|355491736|gb|AES72939.1| Cyclin-dependent kinase E-1 [Medicago truncatula] Length = 474 Score = 75.1 bits (183), Expect = 5e-12 Identities = 38/43 (88%), Positives = 39/43 (90%), Gaps = 2/43 (4%) Frame = -2 Query: 125 PVWLQQYDLIGKIGEGTYGLVFLAKIKS--QRGKSIAIKKFKQ 3 P WLQQYDLIGKIGEGTYGLVFLA+IKS RGKSIAIKKFKQ Sbjct: 12 PEWLQQYDLIGKIGEGTYGLVFLARIKSTTNRGKSIAIKKFKQ 54 >ref|XP_004172297.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-dependent kinase E-1-like, partial [Cucumis sativus] Length = 330 Score = 74.7 bits (182), Expect = 7e-12 Identities = 38/44 (86%), Positives = 39/44 (88%), Gaps = 3/44 (6%) Frame = -2 Query: 125 PVWLQQYDLIGKIGEGTYGLVFLAKIKS---QRGKSIAIKKFKQ 3 P WLQQYDLIGKIGEGTYGLVFLAKIK+ RGKSIAIKKFKQ Sbjct: 32 PEWLQQYDLIGKIGEGTYGLVFLAKIKTPSPSRGKSIAIKKFKQ 75 >ref|XP_004144669.1| PREDICTED: cyclin-dependent kinase E-1-like [Cucumis sativus] Length = 484 Score = 73.9 bits (180), Expect = 1e-11 Identities = 38/44 (86%), Positives = 38/44 (86%), Gaps = 3/44 (6%) Frame = -2 Query: 125 PVWLQQYDLIGKIGEGTYGLVFLAKIK---SQRGKSIAIKKFKQ 3 P WLQQYDLIGKIGEGTYGLVFLAKIK RGKSIAIKKFKQ Sbjct: 32 PEWLQQYDLIGKIGEGTYGLVFLAKIKPPSPSRGKSIAIKKFKQ 75 >ref|XP_002273171.1| PREDICTED: cyclin-dependent kinase E-1 [Vitis vinifera] gi|296082615|emb|CBI21620.3| unnamed protein product [Vitis vinifera] Length = 481 Score = 73.9 bits (180), Expect = 1e-11 Identities = 37/43 (86%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = -2 Query: 125 PVWLQQYDLIGKIGEGTYGLVFLAKIK--SQRGKSIAIKKFKQ 3 P WLQQYDLIGKIGEGTYGLVFLA+ K S RGKSIAIKKFKQ Sbjct: 24 PAWLQQYDLIGKIGEGTYGLVFLARTKSPSNRGKSIAIKKFKQ 66