BLASTX nr result
ID: Coptis21_contig00019296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00019296 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003576484.1| PREDICTED: potassium transporter 23-like [Br... 59 3e-07 gb|AAC24049.1| Similar to HAK1 gb|U22945 high affinity potassium... 59 5e-07 ref|NP_176222.2| putative potassium transporter 12 [Arabidopsis ... 59 5e-07 emb|CAD20577.1| putative potassium transporter [Vicia faba] 58 7e-07 tpg|DAA61261.1| TPA: hypothetical protein ZEAMMB73_872077 [Zea m... 58 7e-07 >ref|XP_003576484.1| PREDICTED: potassium transporter 23-like [Brachypodium distachyon] Length = 874 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -2 Query: 103 QDRSLLYTLTLAFQTLGVVYGDLGTSPLYVFSDV 2 QD SLL T+ +AFQTLGVVYGD+GTSPLYVFSDV Sbjct: 120 QDISLLSTVAMAFQTLGVVYGDMGTSPLYVFSDV 153 >gb|AAC24049.1| Similar to HAK1 gb|U22945 high affinity potassium transporter from Schwanniomyces occidentalis [Arabidopsis thaliana] Length = 826 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -2 Query: 103 QDRSLLYTLTLAFQTLGVVYGDLGTSPLYVFSDV 2 +D SLL TL +AFQTLGVVYGD+GTSPLYVFSDV Sbjct: 81 KDLSLLTTLGIAFQTLGVVYGDMGTSPLYVFSDV 114 >ref|NP_176222.2| putative potassium transporter 12 [Arabidopsis thaliana] gi|38502862|sp|O80739.2|POT12_ARATH RecName: Full=Putative potassium transporter 12; Short=AtPOT12 gi|332195542|gb|AEE33663.1| putative potassium transporter 12 [Arabidopsis thaliana] Length = 827 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -2 Query: 103 QDRSLLYTLTLAFQTLGVVYGDLGTSPLYVFSDV 2 +D SLL TL +AFQTLGVVYGD+GTSPLYVFSDV Sbjct: 81 KDLSLLTTLGIAFQTLGVVYGDMGTSPLYVFSDV 114 >emb|CAD20577.1| putative potassium transporter [Vicia faba] Length = 837 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 112 QCSQDRSLLYTLTLAFQTLGVVYGDLGTSPLYVFSDV 2 Q S+D SL T+ LAFQTLGVVYGD+GTSPLYVF+DV Sbjct: 82 QHSKDLSLWSTIALAFQTLGVVYGDMGTSPLYVFADV 118 >tpg|DAA61261.1| TPA: hypothetical protein ZEAMMB73_872077 [Zea mays] Length = 852 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 106 SQDRSLLYTLTLAFQTLGVVYGDLGTSPLYVFSDV 2 S++ S+L TL +AFQTLGVVYGD+GTSPLYVFSDV Sbjct: 98 SKEISMLSTLAMAFQTLGVVYGDMGTSPLYVFSDV 132