BLASTX nr result
ID: Coptis21_contig00019252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00019252 (369 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19826.3| unnamed protein product [Vitis vinifera] 63 3e-08 ref|XP_002277913.1| PREDICTED: zinc finger CCCH domain-containin... 63 3e-08 ref|XP_003527663.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger ... 59 5e-07 ref|XP_003589157.1| Zinc finger CCCH domain-containing protein [... 58 7e-07 gb|AFK34225.1| unknown [Medicago truncatula] 57 2e-06 >emb|CBI19826.3| unnamed protein product [Vitis vinifera] Length = 170 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 93 KSKRVSWPSDVNLCQVRLFLSEDSPSQVG 7 KSKRVSWPSDVNLCQVRLFLSEDSPSQVG Sbjct: 6 KSKRVSWPSDVNLCQVRLFLSEDSPSQVG 34 >ref|XP_002277913.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like [Vitis vinifera] Length = 457 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 93 KSKRVSWPSDVNLCQVRLFLSEDSPSQVG 7 KSKRVSWPSDVNLCQVRLFLSEDSPSQVG Sbjct: 6 KSKRVSWPSDVNLCQVRLFLSEDSPSQVG 34 >ref|XP_003527663.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing protein 6-like [Glycine max] Length = 431 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 108 MVRSMKSKRVSWPSDVNLCQVRLFLSEDSPSQVGL 4 M R KSKRVSW SD++LCQVRLFLSE+SPSQVGL Sbjct: 1 MRRLQKSKRVSWASDLDLCQVRLFLSEESPSQVGL 35 >ref|XP_003589157.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355478205|gb|AES59408.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Length = 412 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -1 Query: 93 KSKRVSWPSDVNLCQVRLFLSEDSPSQVGL 4 KSKRVSWPS+++LCQVRLFLSE+SPSQVGL Sbjct: 6 KSKRVSWPSELDLCQVRLFLSEESPSQVGL 35 >gb|AFK34225.1| unknown [Medicago truncatula] Length = 412 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -1 Query: 93 KSKRVSWPSDVNLCQVRLFLSEDSPSQVGL 4 KSKRVSWPS+++LCQVRLFLS++SPSQVGL Sbjct: 6 KSKRVSWPSELDLCQVRLFLSDESPSQVGL 35