BLASTX nr result
ID: Coptis21_contig00018516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00018516 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003520106.1| PREDICTED: pentatricopeptide repeat-containi... 120 1e-25 ref|XP_002274352.1| PREDICTED: pentatricopeptide repeat-containi... 120 1e-25 ref|XP_003614017.1| Pentatricopeptide repeat protein [Medicago t... 117 1e-24 ref|XP_002512113.1| pentatricopeptide repeat-containing protein,... 116 2e-24 emb|CBI27276.3| unnamed protein product [Vitis vinifera] 115 4e-24 >ref|XP_003520106.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Glycine max] Length = 518 Score = 120 bits (301), Expect = 1e-25 Identities = 54/72 (75%), Positives = 62/72 (86%) Frame = -1 Query: 217 LIDMYARCGNLVLATKLFDDMGERDTICWNVMISGLAMHGDGQNALKLFKEMDKAGFKPN 38 L+DMYA+CGNL LA +LFD M ERD +CWN MISGLAMHGDG +ALK+F EM+K G KP+ Sbjct: 278 LLDMYAKCGNLELAKRLFDSMPERDIVCWNAMISGLAMHGDGASALKMFSEMEKTGIKPD 337 Query: 37 DITFIAVFTACS 2 DITFIAVFTACS Sbjct: 338 DITFIAVFTACS 349 >ref|XP_002274352.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 536 Score = 120 bits (301), Expect = 1e-25 Identities = 54/72 (75%), Positives = 64/72 (88%) Frame = -1 Query: 217 LIDMYARCGNLVLATKLFDDMGERDTICWNVMISGLAMHGDGQNALKLFKEMDKAGFKPN 38 LIDMYA+CG+L +A KLFD M +RDTICWN MISG+AM+GDG NAL+LF EM+KAG KP+ Sbjct: 278 LIDMYAKCGSLDIAKKLFDGMSQRDTICWNAMISGMAMNGDGDNALRLFSEMEKAGVKPD 337 Query: 37 DITFIAVFTACS 2 DITFIA+FTACS Sbjct: 338 DITFIAIFTACS 349 >ref|XP_003614017.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355515352|gb|AES96975.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 525 Score = 117 bits (292), Expect = 1e-24 Identities = 52/72 (72%), Positives = 61/72 (84%) Frame = -1 Query: 217 LIDMYARCGNLVLATKLFDDMGERDTICWNVMISGLAMHGDGQNALKLFKEMDKAGFKPN 38 L+DMYA+CGNL LA +LFD M RD +CWN MISG+AMHGDG+ ALKLF +M+K G KP+ Sbjct: 281 LLDMYAKCGNLELAKRLFDSMNMRDVVCWNAMISGMAMHGDGKGALKLFYDMEKVGVKPD 340 Query: 37 DITFIAVFTACS 2 DITFIAVFTACS Sbjct: 341 DITFIAVFTACS 352 >ref|XP_002512113.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549293|gb|EEF50782.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 336 Score = 116 bits (291), Expect = 2e-24 Identities = 50/72 (69%), Positives = 64/72 (88%) Frame = -1 Query: 217 LIDMYARCGNLVLATKLFDDMGERDTICWNVMISGLAMHGDGQNALKLFKEMDKAGFKPN 38 LIDMYA+CGN+ LA LFD+M +RDT+CWNVMISGLAMHGDG+ A+ LF +M++AGFKP+ Sbjct: 230 LIDMYAKCGNVDLAKSLFDEMPQRDTVCWNVMISGLAMHGDGEGAINLFLKMEEAGFKPD 289 Query: 37 DITFIAVFTACS 2 D+TFIA+ +ACS Sbjct: 290 DVTFIAILSACS 301 >emb|CBI27276.3| unnamed protein product [Vitis vinifera] Length = 248 Score = 115 bits (288), Expect = 4e-24 Identities = 52/70 (74%), Positives = 62/70 (88%) Frame = -1 Query: 217 LIDMYARCGNLVLATKLFDDMGERDTICWNVMISGLAMHGDGQNALKLFKEMDKAGFKPN 38 LIDMYA+CG+L +A KLFD M +RDTICWN MISG+AM+GDG NAL+LF EM+KAG KP+ Sbjct: 172 LIDMYAKCGSLDIAKKLFDGMSQRDTICWNAMISGMAMNGDGDNALRLFSEMEKAGVKPD 231 Query: 37 DITFIAVFTA 8 DITFIA+FTA Sbjct: 232 DITFIAIFTA 241