BLASTX nr result
ID: Coptis21_contig00017989
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00017989 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278655.1| PREDICTED: RING-H2 finger protein ATL5 [Viti... 69 5e-10 ref|XP_003531024.1| PREDICTED: RING-H2 finger protein ATL54-like... 68 7e-10 ref|XP_003615188.1| RING-H2 finger protein ATL1O [Medicago trunc... 67 1e-09 ref|XP_002884394.1| zinc finger family protein [Arabidopsis lyra... 67 2e-09 ref|XP_002534099.1| ring finger protein, putative [Ricinus commu... 67 2e-09 >ref|XP_002278655.1| PREDICTED: RING-H2 finger protein ATL5 [Vitis vinifera] gi|297745866|emb|CBI15922.3| unnamed protein product [Vitis vinifera] Length = 267 Score = 68.6 bits (166), Expect = 5e-10 Identities = 34/64 (53%), Positives = 39/64 (60%) Frame = -3 Query: 282 GRHLPNCNHAFHVHCIDTWLRSHPNCPICRAVIGSKNVEVKPTLVDDVVFQESSEMLHIE 103 GR+LP C HAFHV CID WL SH NCPICRA + V D+ + QE S IE Sbjct: 133 GRNLPKCGHAFHVQCIDMWLHSHSNCPICRAPAACEKKAVSQP--DEAILQEGS----IE 186 Query: 102 LSDA 91 LS+A Sbjct: 187 LSEA 190 >ref|XP_003531024.1| PREDICTED: RING-H2 finger protein ATL54-like [Glycine max] Length = 358 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = -3 Query: 279 RHLPNCNHAFHVHCIDTWLRSHPNCPICRAVIGSKNVEVKPTLVDDVVFQESS 121 R LP CNHAFH+ CIDTWLRSH NCP+CRA I + V P+ +D F+ SS Sbjct: 173 RLLPKCNHAFHLPCIDTWLRSHTNCPMCRAPIVTDPTRV-PSSMDPTAFETSS 224 >ref|XP_003615188.1| RING-H2 finger protein ATL1O [Medicago truncatula] gi|355516523|gb|AES98146.1| RING-H2 finger protein ATL1O [Medicago truncatula] Length = 352 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 279 RHLPNCNHAFHVHCIDTWLRSHPNCPICRAVIGSKNVEVKPTL 151 R LP C+HAFH+ CIDTWLRSH NCP+CRA I S NV + T+ Sbjct: 168 RLLPKCSHAFHISCIDTWLRSHTNCPLCRAGIVSNNVTPEVTI 210 >ref|XP_002884394.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297330234|gb|EFH60653.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 355 Score = 66.6 bits (161), Expect = 2e-09 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -3 Query: 279 RHLPNCNHAFHVHCIDTWLRSHPNCPICRAVIGSKNV 169 R LP CNHAFHV CIDTWL+SH NCP+CRA I NV Sbjct: 166 RLLPKCNHAFHVPCIDTWLKSHSNCPLCRAFIAGVNV 202 >ref|XP_002534099.1| ring finger protein, putative [Ricinus communis] gi|223525847|gb|EEF28281.1| ring finger protein, putative [Ricinus communis] Length = 344 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/53 (54%), Positives = 36/53 (67%) Frame = -3 Query: 279 RHLPNCNHAFHVHCIDTWLRSHPNCPICRAVIGSKNVEVKPTLVDDVVFQESS 121 R LP C+HAFH+ CIDTWLRSH NCP+CRA + S N +V+ L + SS Sbjct: 105 RLLPKCSHAFHIPCIDTWLRSHKNCPLCRAPVISDNFDVQVELPESTSSDLSS 157