BLASTX nr result
ID: Coptis21_contig00015890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00015890 (919 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510608.1| conserved hypothetical protein [Ricinus comm... 67 8e-09 ref|XP_002510609.1| conserved hypothetical protein [Ricinus comm... 62 2e-07 ref|XP_002510612.1| conserved hypothetical protein [Ricinus comm... 59 2e-06 >ref|XP_002510608.1| conserved hypothetical protein [Ricinus communis] gi|223551309|gb|EEF52795.1| conserved hypothetical protein [Ricinus communis] Length = 406 Score = 66.6 bits (161), Expect = 8e-09 Identities = 26/61 (42%), Positives = 42/61 (68%) Frame = -1 Query: 232 GFFSILDGLTYKLEIPELLGRRICGTAFGWFITVHGNSEMQLLHPFTRKVVQLPALTEFP 53 GF+++ DG TY LE+PE + +R CG++ GW + V + LL+P T+ ++LP+L+ FP Sbjct: 66 GFYNLADGKTYHLELPETIEKRCCGSSHGWLVMVEDTPSIFLLNPLTKARIELPSLSTFP 125 Query: 52 Y 50 Y Sbjct: 126 Y 126 >ref|XP_002510609.1| conserved hypothetical protein [Ricinus communis] gi|223551310|gb|EEF52796.1| conserved hypothetical protein [Ricinus communis] Length = 406 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/60 (41%), Positives = 40/60 (66%) Frame = -1 Query: 232 GFFSILDGLTYKLEIPELLGRRICGTAFGWFITVHGNSEMQLLHPFTRKVVQLPALTEFP 53 GF++ DG TY LE+PE + +R CG++ GW + V + LL+P T+ ++LP+L+ FP Sbjct: 66 GFYNPSDGKTYHLELPETVDKRCCGSSHGWLVMVEDTPSIFLLNPLTKSRIELPSLSTFP 125 >ref|XP_002510612.1| conserved hypothetical protein [Ricinus communis] gi|223551313|gb|EEF52799.1| conserved hypothetical protein [Ricinus communis] Length = 402 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/59 (44%), Positives = 39/59 (66%) Frame = -1 Query: 232 GFFSILDGLTYKLEIPELLGRRICGTAFGWFITVHGNSEMQLLHPFTRKVVQLPALTEF 56 GF++I D Y LE+PE +R CG++ GW I V + + LL+P TR+ ++LPAL+ F Sbjct: 68 GFYNISDDKIYVLELPEAYEKRCCGSSHGWLIMVEDSPSIFLLNPLTRERIELPALSTF 126