BLASTX nr result
ID: Coptis21_contig00015854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00015854 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004165245.1| PREDICTED: uncharacterized protein At3g15000... 66 3e-09 ref|XP_004150496.1| PREDICTED: uncharacterized protein At3g15000... 66 3e-09 ref|XP_002272388.1| PREDICTED: uncharacterized protein At3g15000... 65 7e-09 gb|AFK37344.1| unknown [Medicago truncatula] 62 4e-08 gb|AFK34838.1| unknown [Medicago truncatula] 62 4e-08 >ref|XP_004165245.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Cucumis sativus] Length = 277 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/49 (65%), Positives = 35/49 (71%) Frame = +1 Query: 67 AVSILNNNQNMIHDSRKIPSTPRFKTSGSGYSPLNDPSPNWSNRPPKET 213 A +LN +I S +P RFK SGSGYSPLNDPSPNWSNRPPKET Sbjct: 42 AFPLLNRQDQIIPASFNLPI--RFKASGSGYSPLNDPSPNWSNRPPKET 88 >ref|XP_004150496.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like [Cucumis sativus] Length = 277 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/49 (65%), Positives = 35/49 (71%) Frame = +1 Query: 67 AVSILNNNQNMIHDSRKIPSTPRFKTSGSGYSPLNDPSPNWSNRPPKET 213 A +LN +I S +P RFK SGSGYSPLNDPSPNWSNRPPKET Sbjct: 42 AFPLLNRQDQIIPASFNLPI--RFKASGSGYSPLNDPSPNWSNRPPKET 88 >ref|XP_002272388.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Vitis vinifera] gi|147819172|emb|CAN69219.1| hypothetical protein VITISV_012015 [Vitis vinifera] gi|296083326|emb|CBI22962.3| unnamed protein product [Vitis vinifera] Length = 260 Score = 64.7 bits (156), Expect = 7e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 97 MIHDSRKIPSTPRFKTSGSGYSPLNDPSPNWSNRPPKET 213 ++ +S ++P+ R KTSGSGYSPLNDPSPNWSNRPPKET Sbjct: 47 LVSNSARVPT--RLKTSGSGYSPLNDPSPNWSNRPPKET 83 >gb|AFK37344.1| unknown [Medicago truncatula] Length = 263 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 133 RFKTSGSGYSPLNDPSPNWSNRPPKET 213 RFK+SGSGYSPLNDPSPNWSNRPPKET Sbjct: 55 RFKSSGSGYSPLNDPSPNWSNRPPKET 81 >gb|AFK34838.1| unknown [Medicago truncatula] Length = 263 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 133 RFKTSGSGYSPLNDPSPNWSNRPPKET 213 RFK+SGSGYSPLNDPSPNWSNRPPKET Sbjct: 55 RFKSSGSGYSPLNDPSPNWSNRPPKET 81