BLASTX nr result
ID: Coptis21_contig00015693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00015693 (604 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280494.1| PREDICTED: arabinogalactan peptide 20 [Vitis... 56 6e-06 ref|XP_004133836.1| PREDICTED: arabinogalactan peptide 20-like [... 55 7e-06 >ref|XP_002280494.1| PREDICTED: arabinogalactan peptide 20 [Vitis vinifera] gi|147812721|emb|CAN61749.1| hypothetical protein VITISV_014579 [Vitis vinifera] gi|297745395|emb|CBI40475.3| unnamed protein product [Vitis vinifera] Length = 75 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 256 DGTSIDLGIAYVLMVAALVLTYIIHPLGDASYSLF 360 DGT+ID GIAYVLM+ ALVLTY+IHPL +SYS F Sbjct: 41 DGTAIDQGIAYVLMLVALVLTYLIHPLDASSYSFF 75 >ref|XP_004133836.1| PREDICTED: arabinogalactan peptide 20-like [Cucumis sativus] gi|449477891|ref|XP_004155154.1| PREDICTED: arabinogalactan peptide 20-like [Cucumis sativus] Length = 78 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 256 DGTSIDLGIAYVLMVAALVLTYIIHPLGDASYSLF 360 DGTSID GIAYVLM+ ALVLTY+IHPL +SY+ F Sbjct: 42 DGTSIDQGIAYVLMLLALVLTYLIHPLDASSYNFF 76