BLASTX nr result
ID: Coptis21_contig00015660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00015660 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK92442.1| unknown [Populus trichocarpa] 65 7e-09 emb|CBX87929.1| equilibrative nucleoside transporter 1 [Solanum ... 62 5e-08 ref|XP_002525348.1| nucleoside transporter, putative [Ricinus co... 60 2e-07 ref|XP_004164886.1| PREDICTED: equilibrative nucleotide transpor... 59 5e-07 ref|XP_004147175.1| PREDICTED: equilibrative nucleotide transpor... 59 5e-07 >gb|ABK92442.1| unknown [Populus trichocarpa] Length = 432 Score = 64.7 bits (156), Expect = 7e-09 Identities = 37/67 (55%), Positives = 44/67 (65%), Gaps = 7/67 (10%) Frame = +3 Query: 60 VGILVNEKDSGESEEALLISFAATPT-------NIISYQQIPGDTFHLAYIIYFTLGAGY 218 +G+ E D+ S LL + AAT T + IS Q+IP DTFHLAYIIYFTLG G+ Sbjct: 1 MGLTSTEPDTESS--LLLPTTAATTTTTTTTTNSTISQQKIPKDTFHLAYIIYFTLGLGF 58 Query: 219 LLPWNAF 239 LLPWNAF Sbjct: 59 LLPWNAF 65 >emb|CBX87929.1| equilibrative nucleoside transporter 1 [Solanum tuberosum] Length = 415 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = +3 Query: 84 DSGESEEALLISFAATPTNIISYQQIPGDTFHLAYIIYFTLGAGYLLPWNAF 239 + G SE L+ TP+N +IP DTFH+AYIIYFTLGAGYLLPWNAF Sbjct: 7 NGGGSESTSLL----TPSN----PKIPKDTFHIAYIIYFTLGAGYLLPWNAF 50 >ref|XP_002525348.1| nucleoside transporter, putative [Ricinus communis] gi|223535311|gb|EEF36986.1| nucleoside transporter, putative [Ricinus communis] Length = 425 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +3 Query: 93 ESEEALLISFAATPTNIISYQQIPGDTFHLAYIIYFTLGAGYLLPWNAF 239 + E +LL+S +P + +S + +P DTF+ AYIIYFTLG G+LLPWNA+ Sbjct: 13 DCESSLLLSTTTSPNHTLS-KNVPKDTFNFAYIIYFTLGVGFLLPWNAY 60 >ref|XP_004164886.1| PREDICTED: equilibrative nucleotide transporter 1-like [Cucumis sativus] Length = 418 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/50 (60%), Positives = 34/50 (68%) Frame = +3 Query: 90 GESEEALLISFAATPTNIISYQQIPGDTFHLAYIIYFTLGAGYLLPWNAF 239 G+SE IS AT T ++P D+FH AYIIYFTLG GYLLPWNAF Sbjct: 6 GDSES---ISLLATTTVSPIPNKVPKDSFHFAYIIYFTLGFGYLLPWNAF 52 >ref|XP_004147175.1| PREDICTED: equilibrative nucleotide transporter 1-like [Cucumis sativus] Length = 418 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/50 (60%), Positives = 34/50 (68%) Frame = +3 Query: 90 GESEEALLISFAATPTNIISYQQIPGDTFHLAYIIYFTLGAGYLLPWNAF 239 G+SE IS AT T ++P D+FH AYIIYFTLG GYLLPWNAF Sbjct: 6 GDSES---ISLLATTTVSPIPNKVPKDSFHFAYIIYFTLGFGYLLPWNAF 52