BLASTX nr result
ID: Coptis21_contig00014954
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00014954 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003620173.1| hypothetical protein MTR_6g078110 [Medicago ... 55 8e-06 >ref|XP_003620173.1| hypothetical protein MTR_6g078110 [Medicago truncatula] gi|355495188|gb|AES76391.1| hypothetical protein MTR_6g078110 [Medicago truncatula] Length = 265 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/55 (47%), Positives = 40/55 (72%) Frame = -1 Query: 199 IILHPLVLRIKSDYQLEL*AWYLDDGTLIGDTKQVATTFHIVQEIGPSLGLILNV 35 ++LHPL+ +I+ +L L AWYL+D TLIGD+++VA + I++ P LGL LN+ Sbjct: 34 LMLHPLIHQIRYSCKLLLHAWYLNDETLIGDSEKVAKSLDIIRVSRPELGLELNI 88