BLASTX nr result
ID: Coptis21_contig00014924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00014924 (416 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA36390.1| TPA: putative cytochrome P450 superfamily protei... 68 7e-10 ref|NP_001182854.1| putative cytochrome P450 superfamily protein... 68 7e-10 ref|XP_002270497.2| PREDICTED: cytochrome P450 704C1-like [Vitis... 67 1e-09 ref|XP_003581548.1| PREDICTED: cytochrome P450 704C1-like [Brach... 67 1e-09 emb|CBI24484.3| unnamed protein product [Vitis vinifera] 67 1e-09 >tpg|DAA36390.1| TPA: putative cytochrome P450 superfamily protein [Zea mays] Length = 507 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/60 (48%), Positives = 44/60 (73%) Frame = +3 Query: 51 KSGPPICAGKKFTYSRMKLFASVLLHLFVYELWEKKKTVDYKTIITLHVDVPLDLPVSRR 230 ++GP +C GK+F Y +MK+FA+VLL+LF +E+W+ TV Y+ ++TL +D PL L S R Sbjct: 447 QAGPRVCLGKEFAYRQMKIFAAVLLYLFRFEMWDANATVGYRAMLTLKIDRPLYLRTSLR 506 >ref|NP_001182854.1| putative cytochrome P450 superfamily protein [Zea mays] gi|238007736|gb|ACR34903.1| unknown [Zea mays] gi|413946945|gb|AFW79594.1| putative cytochrome P450 superfamily protein [Zea mays] Length = 454 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/60 (48%), Positives = 44/60 (73%) Frame = +3 Query: 51 KSGPPICAGKKFTYSRMKLFASVLLHLFVYELWEKKKTVDYKTIITLHVDVPLDLPVSRR 230 ++GP +C GK+F Y +MK+FA+VLL+LF +E+W+ TV Y+ ++TL +D PL L S R Sbjct: 394 QAGPRVCLGKEFAYRQMKIFAAVLLYLFRFEMWDANATVGYRAMLTLKIDRPLYLRTSLR 453 >ref|XP_002270497.2| PREDICTED: cytochrome P450 704C1-like [Vitis vinifera] Length = 513 Score = 67.0 bits (162), Expect = 1e-09 Identities = 28/61 (45%), Positives = 45/61 (73%) Frame = +3 Query: 51 KSGPPICAGKKFTYSRMKLFASVLLHLFVYELWEKKKTVDYKTIITLHVDVPLDLPVSRR 230 ++GP +C GK F Y +MK+FA++LL F+++L ++ K V+YKT+I LH+D LD+ S R Sbjct: 445 QAGPRVCLGKDFAYRQMKIFAAILLSSFIFKLSDENKAVNYKTMINLHIDGGLDVHASHR 504 Query: 231 V 233 + Sbjct: 505 L 505 >ref|XP_003581548.1| PREDICTED: cytochrome P450 704C1-like [Brachypodium distachyon] Length = 511 Score = 67.0 bits (162), Expect = 1e-09 Identities = 28/60 (46%), Positives = 46/60 (76%) Frame = +3 Query: 51 KSGPPICAGKKFTYSRMKLFASVLLHLFVYELWEKKKTVDYKTIITLHVDVPLDLPVSRR 230 ++GP IC GK+F Y +MK+FA+VLL+LF +E+WE+ T+ ++ ++TL +D PL++ V R Sbjct: 445 QAGPRICLGKEFAYRQMKIFAAVLLYLFRFEMWERNSTMGFRPMLTLKMDGPLNVRVLPR 504 >emb|CBI24484.3| unnamed protein product [Vitis vinifera] Length = 500 Score = 67.0 bits (162), Expect = 1e-09 Identities = 28/61 (45%), Positives = 45/61 (73%) Frame = +3 Query: 51 KSGPPICAGKKFTYSRMKLFASVLLHLFVYELWEKKKTVDYKTIITLHVDVPLDLPVSRR 230 ++GP +C GK F Y +MK+FA++LL F+++L ++ K V+YKT+I LH+D LD+ S R Sbjct: 432 QAGPRVCLGKDFAYRQMKIFAAILLSSFIFKLSDENKAVNYKTMINLHIDGGLDVHASHR 491 Query: 231 V 233 + Sbjct: 492 L 492